KEGG   Spirosoma linguale: Slin_4384Help
Entry
Slin_4384         CDS       T01156                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sli  Spirosoma linguale
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Slin_4384
   00051 Fructose and mannose metabolism
    Slin_4384
Enzymes [BR:sli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Slin_4384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5319780..5321120
Genome map
AA seq 446 aa AA seqDB search
MSDVKLTLGEKTYFPFIEKPIAYEGRESDNPLAFKFYDANRLILGKPMKDLFRFATAYWH
TFCGTGADPFGPGVKHFPWDANPDPLAAAHDKMDAAFEFITKIGMEFYCFHDVDVAPEGN
SNSEFEKNFRAIVDYAKQKQAASGVKLLWGTANLFSHERYMNGASTNPDFHVLAHGGWQV
KNAIDATIELGGAGYTFWGGREGYMSLLNTNMKREQEHLGKFLQISRDYARKQGFKGSFY
IEPKPMEPTKHQYDFDAATVVGFLNRFGLQDDFELNIETNHATLANHTFAHELQIAADNN
MLGSIDANRGDYQNGWDTDQFPVDVYELTEAMLVILEADGLKSGGVNFDAKTRRNSTDLD
DIFIAHIGGMDTFARAAIAAEAILDKSQYRKLRAERYASYDSGEGARFEKGELTLEDLRQ
YAMTNGEPKQLSGKQELYEMIVNQYI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgttaaattgaccctcggcgagaaaacttactttccgttcatagaaaaacca
attgcctacgaaggccgtgaatcggataatccgttggccttcaagttctacgacgccaac
cgactcattctgggcaaaccgatgaaggatctgttccggtttgctacggcttactggcat
accttctgcggtaccggagccgacccctttggtccgggtgtcaagcattttccctgggat
gccaaccccgacccgctggccgctgcccatgataagatggatgccgctttcgagtttatc
accaaaataggcatggagttttactgcttccacgatgtagacgtggcccccgaaggaaac
tctaacagtgaattcgagaagaacttccgggctattgtcgactacgccaaacagaagcag
gccgccagtggtgtaaaactgctgtggggcacggccaacctgttctcgcacgagcggtac
atgaacggggcctccaccaaccctgattttcacgtgctcgcccatggtggctggcaggtg
aaaaacgccatcgacgccaccatcgaactcgggggcgcaggctatactttctggggaggc
cgggaagggtacatgtcgctgctgaataccaacatgaaacgggagcaggaacacctgggc
aagtttctgcaaatcagccgcgattacgcccgtaagcagggttttaaaggttcgttttac
atcgagcccaaaccgatggagcccaccaaacaccagtacgatttcgatgcagcaacggtt
gtcggtttcctgaatcgctttggcttacaggacgacttcgagctaaacatcgaaaccaac
cacgccaccctagctaatcatacgtttgcccacgaattgcagattgccgccgataacaac
atgctcggcagcatcgacgccaaccggggcgattaccagaatggctgggataccgaccag
tttccggtagatgtatacgaactgacggaagccatgctggtcattctggaagcggatggc
ctcaaatccggcggggttaacttcgacgccaagacgcgccggaattcaaccgacctggac
gatattttcatcgcccacattggcggcatggacaccttcgcacgggcagccatcgcggcc
gaagccattcttgataagtcgcagtaccggaaactccgcgccgaacgttacgccagctac
gactcgggcgaaggtgcccgtttcgaaaaaggtgagttaacgctggaagacctgcgccag
tatgccatgaccaatggcgagcccaaacaactcagcggcaaacaggagctgtatgaaatg
atcgttaatcagtatatttaa

DBGET integrated database retrieval system