KEGG   Spirosoma linguale: Slin_4404Help
Entry
Slin_4404         CDS       T01156                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sli  Spirosoma linguale
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5339097..5339576)
Genome map
AA seq 159 aa AA seqDB search
MKTILLLGANLGDRVQTLNRSVDLISERVGTIAQQSAFYETAPWGVTDQPAYVNQVLVVE
TALKPDDVLAQTQGIEQALGRVRLEKWGARVIDIDILYYDQLIQQTDTLTIPHPFLHQRR
FTLVPLAEIAPDFMHPVLQKTTLELLADCEDEGEVMLVY
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactattcttctcctcggcgcaaacctcggcgaccgtgttcagacgcttaaccgg
tccgtagatctgatttcagagcgtgttggaacgatagctcagcagtcggctttctacgaa
acggctccctggggcgttaccgaccaacccgcttatgtgaatcaggtgctcgtcgttgaa
actgcgctgaagcccgacgatgttcttgcacagacgcagggtatcgagcaggcactcggt
cgggtgagactggaaaagtggggtgcccgcgtcattgatattgacatactgtattacgac
cagctcattcagcaaacggatacacttaccattccgcatccgtttctacaccagcgacgc
tttacgctcgtgccactggcagaaatagccccggattttatgcatcctgttttacagaaa
acgacccttgagttactggctgattgtgaagacgaaggagaggtgatgctagtgtattga

DBGET integrated database retrieval system