KEGG   Spirosoma linguale: Slin_4502Help
Entry
Slin_4502         CDS       T01156                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sli  Spirosoma linguale
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Slin_4502
Enzymes [BR:sli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Slin_4502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5456712..5457308
Genome map
AA seq 198 aa AA seqDB search
MIAYLDGTLSHKEATHVIIDVHGVGYSVHISLQTYAVLPGGGDRIKLFIHHLFREDSQSL
YGFANADEKSLFLDLIGVSGVGPNTALGMLSAMQPGDLRLAILGENVRAVQAIKGIGAKT
AQRIILELRDKMKRAGVVPDGPSYRQQAAANPVREESLAALVALGFPKPTAEKSVDDALK
ADPALSVEDVIRRALRQP
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttatttagacggaactctgtcccataaagaagctacccatgtcatcatcgac
gtacatggagtcggctattcagtacatatatcacttcagacatacgcggtactgcccggt
ggtggcgaccgaattaaattgtttatccaccatctctttcgggaagactctcagtcactc
tatgggttcgccaatgctgatgaaaagagcctgtttctggatttgatcggtgtatcaggc
gttggcccaaacaccgctctcggtatgctgtcggctatgcagccgggcgatttacgactg
gcaattctcggcgaaaacgttcgggctgtacaggccatcaagggcattggtgctaaaaca
gcccagcgtattattctggaactacgcgataaaatgaaacgggccggtgttgtaccggat
ggtccatcgtatcgtcagcaagcggctgcgaaccccgttcgggaagaatcactggccgcc
ctggtcgccttgggtttccctaaaccaacggcggagaaaagtgttgatgatgcgttgaaa
gccgatccggcgctaagcgtggaagacgttattcgacgggcattgcgtcagccttaa

DBGET integrated database retrieval system