KEGG   Spirosoma linguale: Slin_4601Help
Entry
Slin_4601         CDS       T01156                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sli  Spirosoma linguale
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sli01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:sli00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sli00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5583326..5584516
Genome map
AA seq 396 aa AA seqDB search
MCQNHGVAYIKPGVVEVQSIDYPKLALGDRKCHHGVILQIVSTNICGSDQHMVRGRTTAP
AGLVLGHEITGLVIEAGRDVEFIKEGDLVSVPFNIACGRCRNCKVGQTGICLNVNPARPG
AAYGYVDMGGWVGGQAEYVMVPYADFNLLKFPDKDQAMAKIRDLTLLSDIFPTGYHGAVM
AGVGPGSIVYVAGAGPVGLACAASCHLLGAAVVIVGDMIPERLEQAKSFGCETIDLRNEA
SLADQIAAIIGVPEVDSAVDCVGFEARGHGADAATEQPATVLNAAMTITRAGGAIGIPGL
YVTGDPGASTEAAKEGNLNIRIGLGWAKSHSFYTGQCPVMKYHRQLMNAILYDKIQIAKA
VNVEVISLDKAPKGYQDFDKGAAKKFVIDPHGMIPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaaaatcatggtgttgcgtatatcaaacccggcgtggttgaagtccaatccatt
gactacccgaagctggcccttggcgaccgaaaatgtcaccatggggttattctgcaaatc
gtttcgaccaacatctgcggcagcgaccagcacatggttcgggggcggacaacggcacct
gccggtctggtgctgggacacgaaataacgggcctggttatcgaagccggtcgcgatgtg
gagtttatcaaagaaggcgacctggtctcggttccgttcaatattgcctgcgggcgttgc
cgcaattgcaaagtgggtcaaacgggcatatgcctgaatgtgaaccccgcccgccctggt
gcggcttacggatacgtcgacatgggcggctgggttggcggacaggccgaatacgtgatg
gtgccctacgccgattttaacttgctgaagtttccggataaagatcaggcaatggccaaa
attcgcgatctgacactcctctccgacattttcccaacgggctatcatggggccgttatg
gccggtgtgggaccggggtcgattgtgtacgttgcgggtgccggacccgttggcctggcc
tgtgccgcttcctgtcatttgctcggagccgccgtcgttattgttggcgacatgattccc
gagcggctggagcaagccaaaagcttcggttgtgaaacgatcgacctccgcaacgaagcc
tcgctggccgaccagattgccgcgatcatcggcgtgcccgaagtggattcagctgtcgac
tgcgtaggttttgaagcacgcggccacggcgccgatgccgccacggagcaaccagccacc
gtgctgaatgccgccatgaccattacccgggcgggcggggccatcggtatccccggcctc
tacgtaacgggcgaccccggggcctcgacagaagccgccaaagaaggtaatcttaacatt
cgtattggactgggctgggcaaaatcacactcgttctacacgggccagtgtccggttatg
aaataccaccggcagttgatgaatgccattctgtacgataagatacagattgccaaagcc
gtcaatgtggaagtgatcagtttggacaaagcccctaaaggctaccaggatttcgacaaa
ggggccgccaagaaattcgtgatcgatccccacggaatgattcccaattaa

DBGET integrated database retrieval system