KEGG   Spirosoma linguale: Slin_4739Help
Entry
Slin_4739         CDS       T01156                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sli  Spirosoma linguale
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Slin_4739
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Slin_4739
Enzymes [BR:sli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Slin_4739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5774000..5775496
Genome map
AA seq 498 aa AA seqDB search
MFVALRMQLKDIFYKIPLLATSGSMNTEVTSLTMDSRKAGPGSLFIAVRGTVTDGHAYIE
TAIQQGATAILCEEIPAETNPDVAYIRVQNSARTMGLVAANFYDQPSQKLKLIGVTGTNG
KTSVATLLFRLFRALGYRCGLLSTVQNQIDDDVIPATHTTPDVITTNQLLTKMLAHGCTH
VFMEVSSHAVVQERIAGLSFVGGIFTNITHDHLDFHGTFDNYIRAKKGFFDQLPASAFAL
TNVDDKRGLVMLQNTVARKETYSLQTLASFKGKILADSLFGLNMLIDEREVWFKLIGQFN
AYNLLSVYGTAILLGEDPTEVLTMLSGITPPPGRFEQVVSDDKIVGIVDYAHTPDALQNV
LETINELRSTDEQDYMPQIITVVGCGGNRDTSKRPIMADIACRLSNRVILTSDNPRNEDP
MDILEQMQAGVSPVDFKKTITIEDRHEAIRKAVELAKPHDIILVAGKGHETYQEIKGIKY
DFDDRVVLRDAFADRRNQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgccctacgcatgcaactaaaagatattttctataaaattccgctgctggct
acgtccggcagtatgaataccgaggtaacaagcctgacgatggactcgcgcaaagccggt
ccgggcagcctgtttattgccgttcgcggcaccgttacggacggccatgcgtatatcgaa
acggctattcagcagggagcgaccgctatcctgtgcgaagaaatcccggccgaaaccaac
ccggacgttgcttatatccgggtgcagaattcggcccgaacgatggggttggtggccgct
aacttctacgaccagccttcacaaaaactcaaactaattggggtaacgggtaccaatggc
aaaacgtcggtagctaccttgctcttccggttgtttcgcgccctgggctaccgctgcgga
ctcctgtcgaccgttcagaatcagatcgatgacgatgtaattccggccacccacaccaca
cccgacgtcatcacgaccaatcaattactgaccaaaatgctggcgcacggctgtacgcac
gtattcatggaggtcagttcgcacgcggttgtgcaggaacgaattgccggattgagtttt
gtaggtggaattttcaccaacatcacccacgaccacctcgattttcacggtacgttcgat
aattatattcgcgcaaaaaaggggttcttcgaccagctcccggcatcggcctttgcccta
accaatgtagacgacaagcgtgggctggtcatgcttcagaatacagtggcccgcaaggag
acgtactctctccaaacactagcgtcttttaaaggaaaaattctggctgacagcctgttc
gggctgaacatgctcatcgacgagcgcgaagtgtggttcaagctcatcggccagtttaac
gcctataacctcctcagcgtctatggtacggctattctgctgggcgaagacccaaccgaa
gttctgacaatgctatcgggcattacccccccgcccggtcggttcgagcaggttgtttcg
gacgacaagattgttggtattgttgactatgctcatacgcccgatgccctgcaaaacgta
ttggaaaccattaacgagctgcgcagtacagatgaacaggattacatgccccagatcatt
acggtcgtgggctgtggcggcaaccgggacacctccaaacgacccattatggccgatata
gcctgccggttaagcaaccgcgttatcctgacctccgacaatccacggaacgaagacccc
atggacattctggagcagatgcaggctggtgtctcaccggtcgatttcaaaaaaacgatc
accatcgaagaccggcacgaggccatccgcaaagccgttgaactggccaaaccacatgac
ataattctggtagccggtaaaggccatgagacctatcaggagataaaaggaatcaaatat
gatttcgatgaccgggtcgtactgcgggacgctttcgcagaccgtcgaaatcagtaa

DBGET integrated database retrieval system