KEGG   Spirosoma linguale: Slin_4787Help
Entry
Slin_4787         CDS       T01156                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sli  Spirosoma linguale
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sli00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sli00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5835418..5836431
Genome map
AA seq 337 aa AA seqDB search
MIKNLLFLFPILLTIGAFAQTTPPASVTYPASFTVAQDGSGNFKTIQEAVNSFRDHSQVR
VTLYVRNGVYAEKLVIPSWKPNIHIIGESREGVIITGDDFSGKAYPGGKDWTGKDKHSTY
TTYTVLVDAPETILENLTIRNTAGRVGQAVALHVEADRFVCRTCNLLGNQDTLFAAAEGS
RQYYENCFIEGTTDFIFGKSVSVFQSCTIKSLSDSFITAAATPIYQPYGFIFFDCKLTAD
PTAKKVFLGRPWRPNAKTVFVRTQMDSHILPAGWDNWNNAENEKTVLYAEYGSTGPGSAS
SARVGWSKQLTAKDVKQLTLATIFSGKSPWVPVAQHP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaacctcctgtttctattcccgattctcctcaccatcggcgcctttgcccag
acaacgccaccggcgtcggtaacctacccggcttcgtttacggtggcgcaggatggcagt
ggtaatttcaaaaccattcaggaagcagtcaactcgttccgcgaccactcgcaggttcgg
gtgacgctgtacgtcaggaatggcgtttatgccgaaaaactggtcatcccgtcgtggaaa
ccgaacattcatatcatcggcgaaagcagggagggcgtaatcatcaccggcgatgacttc
tccggaaaggcgtatcccggcgggaaagactggacgggtaaggacaaacacagcacctat
acaacgtatacggtgctggtcgatgcgccggaaacgatcctcgaaaacctgaccattcgg
aacaccgctggccgggttgggcaggcggtggcgctgcatgtagaagccgatcggttcgtt
tgccggacctgtaatttgctgggcaatcaggacacccttttcgcagccgcggagggcagt
cgtcagtactacgaaaactgttttattgaaggtacgaccgattttatcttcggcaagtcg
gtgtccgtttttcagtcgtgtaccattaaaagcctgtcggattcgttcatcaccgcagcc
gccacacccatctaccaaccgtatgggttcatctttttcgactgcaaacttaccgccgac
ccgaccgccaaaaaagtatttctggggcgtccgtggcgaccaaatgccaaaacggttttc
gtccgaacgcagatggacagccacattctgcctgcgggctgggacaactggaacaatgcg
gagaacgaaaaaacggttctgtacgctgaatacggcagcactggaccgggcagcgcatca
tcggcgcgggttggctggtcgaagcagcttacggccaaagacgttaagcaattgacgctg
gcaacgatcttctcgggtaaatcgccctgggtgcctgtcgcccaacacccttaa

DBGET integrated database retrieval system