KEGG   Spirosoma linguale: Slin_5028Help
Entry
Slin_5028         CDS       T01156                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sli  Spirosoma linguale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sli01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sli00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sli00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6131202..6132824
Genome map
AA seq 540 aa AA seqDB search
MAVDMKIPPVGESITEVTVGTWYKKEGDHVKMDDVLCGLDSDKATFELTAEADGVLHILA
QEGDVLPIGASICTIDGDGSAPAPAPAAEPAKAAAPAPSAPAPQPTPAMQSVAEPAQAAV
ATPAAATSVIEMKVPAVGESVTEVTIASWSKKDGDQVALDEVLCELESDKATFELPAEAA
GILRIVAQAGETLPIGALIAKIEVGAATAAPAAAPAPQPAASAPAADTSANGQNGTSYAA
NYPSPAAAKILDEKGVNAQQVQGTGVGGRITKDDAMKASPAPAPAPQPAAAKPAAPAPAP
AAPSVPGSRNQRREKMTSLRRTIARRLVAVKNETAMLTTFNEVDMKPIMDLRNKFKDKFK
EKNGVGLGFMSFFTKAVCIALKDFPAVNAQIDGDQMVFNDFCDISIAVSSDRGLVVPVIR
NAEQLSFAQIEKEVVRLAGLARENKLTIEQMTGGTFTITNGGTFGSMLSTPIINAPQSAI
LGMHNIVERAVVVNGEIVIRPIMYVALSYDHRIIDGKESVSFLVRVKQILEDPTRILFDM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgacatgaaaatccctcccgtgggggaatccattaccgaagtaactgttggt
acctggtataaaaaagaaggtgaccacgtaaaaatggacgatgtgctttgcggactcgac
tccgacaaggccacgttcgaacttactgctgaagccgatggcgttctgcacattctggcg
caggagggcgatgtgttgcctattggagccagcatttgcaccatcgatggtgatggcagt
gctccggcacctgccccggcagccgagccagctaaagctgccgcaccggctccgtcagca
cctgctccacagcctactccggcaatgcagtcggtagcggaacccgcacaggcagccgta
gctactcccgcagcagctaccagtgtcattgaaatgaaagttccggccgttggtgaatcc
gttacagaagtgacgattgcctcctggagcaaaaaagatggtgatcaggtggcccttgat
gaagttctctgcgaactcgaatccgacaaggccaccttcgaactcccagcagaagccgcc
ggtatactccgtatcgtagctcaggctggcgaaacgctgcccatcggtgcgttgatcgcc
aaaatagaagttggtgccgctactgctgctccggccgctgcccccgcgccacaacctgct
gcgagtgcccccgctgccgatacatcggccaatggtcagaacggtaccagctatgcagca
aattacccgtcgccggcagccgctaagattctggacgagaaaggcgttaatgcgcaacaa
gttcagggtaccggcgttggcggacgtattacaaaagacgatgccatgaaagcatcgccc
gcacctgctccggcacctcagccagcagcggctaaacccgcggctccggcaccagcacca
gcggctccttctgtaccgggcagccgcaaccagcgtcgcgaaaaaatgacgtcactccgc
cggacaatcgcccgccggttagtggccgttaagaatgagacagctatgctgactaccttc
aacgaggtagacatgaagccgatcatggacctgcggaacaagttcaaagacaagttcaaa
gagaaaaatggcgtagggcttggctttatgtcgttcttcacgaaggctgtttgtattgcg
ctgaaagatttcccggctgtaaatgctcaaatcgacggcgatcagatggtgttcaacgat
ttctgcgatatttcaatcgccgtttcgtcagaccgtggtctggttgttcccgttatccgg
aatgccgagcagttgagttttgcgcaaattgagaaagaagtcgttcgtttggcgggtctg
gctcgtgaaaacaaactgaccatcgagcaaatgacgggtggtacgttcaccattactaat
ggcggtacattcggatcgatgctgtcgacgccgattatcaatgcaccacagtcggctatt
ctgggtatgcacaacattgttgagcgtgcggtagtcgtcaacggcgaaatcgttatccgc
ccgatcatgtacgtagcgctttcgtacgatcaccggatcatcgatggtaaagaatccgtt
agcttcctggttcgcgtaaagcaaattctggaagacccaacccggattctgttcgatatg
taa

DBGET integrated database retrieval system