KEGG   Spirosoma linguale: Slin_5028Help
Entry
Slin_5028         CDS       T01156                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sli  Spirosoma linguale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slin_5028
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slin_5028
  Amino acid metabolism
   00310 Lysine degradation
    Slin_5028
Enzymes [BR:sli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Slin_5028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6131202..6132824
Genome map
AA seq 540 aa AA seqDB search
MAVDMKIPPVGESITEVTVGTWYKKEGDHVKMDDVLCGLDSDKATFELTAEADGVLHILA
QEGDVLPIGASICTIDGDGSAPAPAPAAEPAKAAAPAPSAPAPQPTPAMQSVAEPAQAAV
ATPAAATSVIEMKVPAVGESVTEVTIASWSKKDGDQVALDEVLCELESDKATFELPAEAA
GILRIVAQAGETLPIGALIAKIEVGAATAAPAAAPAPQPAASAPAADTSANGQNGTSYAA
NYPSPAAAKILDEKGVNAQQVQGTGVGGRITKDDAMKASPAPAPAPQPAAAKPAAPAPAP
AAPSVPGSRNQRREKMTSLRRTIARRLVAVKNETAMLTTFNEVDMKPIMDLRNKFKDKFK
EKNGVGLGFMSFFTKAVCIALKDFPAVNAQIDGDQMVFNDFCDISIAVSSDRGLVVPVIR
NAEQLSFAQIEKEVVRLAGLARENKLTIEQMTGGTFTITNGGTFGSMLSTPIINAPQSAI
LGMHNIVERAVVVNGEIVIRPIMYVALSYDHRIIDGKESVSFLVRVKQILEDPTRILFDM
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgacatgaaaatccctcccgtgggggaatccattaccgaagtaactgttggt
acctggtataaaaaagaaggtgaccacgtaaaaatggacgatgtgctttgcggactcgac
tccgacaaggccacgttcgaacttactgctgaagccgatggcgttctgcacattctggcg
caggagggcgatgtgttgcctattggagccagcatttgcaccatcgatggtgatggcagt
gctccggcacctgccccggcagccgagccagctaaagctgccgcaccggctccgtcagca
cctgctccacagcctactccggcaatgcagtcggtagcggaacccgcacaggcagccgta
gctactcccgcagcagctaccagtgtcattgaaatgaaagttccggccgttggtgaatcc
gttacagaagtgacgattgcctcctggagcaaaaaagatggtgatcaggtggcccttgat
gaagttctctgcgaactcgaatccgacaaggccaccttcgaactcccagcagaagccgcc
ggtatactccgtatcgtagctcaggctggcgaaacgctgcccatcggtgcgttgatcgcc
aaaatagaagttggtgccgctactgctgctccggccgctgcccccgcgccacaacctgct
gcgagtgcccccgctgccgatacatcggccaatggtcagaacggtaccagctatgcagca
aattacccgtcgccggcagccgctaagattctggacgagaaaggcgttaatgcgcaacaa
gttcagggtaccggcgttggcggacgtattacaaaagacgatgccatgaaagcatcgccc
gcacctgctccggcacctcagccagcagcggctaaacccgcggctccggcaccagcacca
gcggctccttctgtaccgggcagccgcaaccagcgtcgcgaaaaaatgacgtcactccgc
cggacaatcgcccgccggttagtggccgttaagaatgagacagctatgctgactaccttc
aacgaggtagacatgaagccgatcatggacctgcggaacaagttcaaagacaagttcaaa
gagaaaaatggcgtagggcttggctttatgtcgttcttcacgaaggctgtttgtattgcg
ctgaaagatttcccggctgtaaatgctcaaatcgacggcgatcagatggtgttcaacgat
ttctgcgatatttcaatcgccgtttcgtcagaccgtggtctggttgttcccgttatccgg
aatgccgagcagttgagttttgcgcaaattgagaaagaagtcgttcgtttggcgggtctg
gctcgtgaaaacaaactgaccatcgagcaaatgacgggtggtacgttcaccattactaat
ggcggtacattcggatcgatgctgtcgacgccgattatcaatgcaccacagtcggctatt
ctgggtatgcacaacattgttgagcgtgcggtagtcgtcaacggcgaaatcgttatccgc
ccgatcatgtacgtagcgctttcgtacgatcaccggatcatcgatggtaaagaatccgtt
agcttcctggttcgcgtaaagcaaattctggaagacccaacccggattctgttcgatatg
taa

DBGET integrated database retrieval system