KEGG   Spirosoma linguale: Slin_5052Help
Entry
Slin_5052         CDS       T01156                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sli  Spirosoma linguale
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Slin_5052
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Slin_5052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6155369..6157132)
Genome map
AA seq 587 aa AA seqDB search
MRVSVIILLLLATRLVNGQSLSTTIRLNQVGFYPNAAKVAVIVHDAGASAASGKFQLMTP
DQKKVVFTGTLSGPKQNQISGKTSQFADFSAFKQKGTYVVAVPGLGHSYPVEIRPDVHRA
AAIGALKGFYYQRTSTDLPARYAGKWARPAGHPDTRVLIHPSAVSPGRSAGTVISSPRGW
YDAGDYNKYIVNSGITVGTLLSLYEDFPAYAKSFDTNIPETGNAVPDLLDEVLWNLRWML
TMQDPADGGVYHKLTNPSFDGMVMPDKATKDRYVIQKSITATLDFAAVLAQASRVFKQYN
KALPGLSDSCRTAAVKAWKWAEQNPNAVYRQNEMNTQFDPDVVTGSYEDRDASDEWVWAA
LELYVTTKDDAYYTAAKLKSDEKLSLPSWNQVRLLGYYTLARFANELTPLGKQGSESVKK
QLLAFADDLIQGTDQQAYGTVMGKSARDYIWGSSSVAANQGIALIQAYNLTKDNRYLRFA
LTNLDYLLGRNATGYSLLTGFGAKPIMNPHHRPSVADGITEPVPGLLSGGPNGNAPKQDK
CPGYTATSADEMLLDDSCSYASNEIAINWNAPLVYLATAIEALQTKL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtttctgtaatcatacttctcttgttggccaccagattggtcaatggacaatct
ctgtccacaactattaggctcaatcaggttgggttttaccctaatgccgcaaaagtggcc
gtgattgtacatgatgcaggcgcatctgccgcgtccggtaagtttcagcttatgactccc
gaccagaaaaaggttgtctttacgggtacgttgagtggccctaaacagaaccagatttcg
ggtaagacaagccaattcgctgacttttcggcttttaaacagaaggggacttatgttgta
gccgtacccggtttgggccactcgtacccggtcgagattcggccggatgttcaccgggcc
gcagccattggtgctctgaaaggattttattatcagcgtacgtctaccgacttacccgcc
aggtatgccggtaaatgggcccgtccggccgggcatccggacactcgggtcttgattcac
ccatcggccgtttcgccagggcgctcggcgggtacggttatttcgtcgcccagggggtgg
tacgatgcgggcgattacaataagtacatcgtcaattcgggcattacggtgggcacgctg
ctttctctgtacgaagacttccctgcctatgccaaatcgttcgataccaacattcccgaa
acaggcaatgctgttcccgatctgctggacgaagtgctctggaacctccgctggatgctg
accatgcaggacccggctgatgggggcgtttaccataaattgacgaatccaagcttcgat
gggatggttatgcccgataaagccacaaaagatcggtatgtgattcagaaaagcattacc
gcaaccctcgattttgccgctgtactggcccaggccagccgggtattcaaacagtacaac
aaagcattgcccggcctatcggactcctgccgcacggcggctgtgaaagcctggaaatgg
gctgagcaaaaccccaacgccgtctatcgtcagaacgaaatgaatacgcagttcgacccc
gacgtggtaacggggagttacgaagaccgcgatgctagcgacgagtgggtttgggctgcg
cttgaactgtatgtgacgacaaaagacgacgcctattatacggctgcaaaactaaaatcg
gatgagaagctaagcttaccctcctggaatcaggttcgcctgttggggtattatacacta
gcccgctttgcgaatgagcttacaccccttggtaaacagggaagcgagtcggtgaagaaa
caactgcttgcctttgccgatgaccttattcagggaacagaccagcaggcgtatggtacg
gtgatgggcaaatcggcgcgggattacatttgggggagtagctccgttgccgctaaccag
ggtattgcgctgattcaggcgtacaacctcaccaaagataaccgctacctgcggtttgcc
ttaaccaatctcgactatctgctgggccgcaatgcaacgggctactcgttgttgacggga
tttggcgccaaaccgattatgaatccgcaccatcggccatccgtagccgacggaatcacc
gaaccagtaccaggcctactatcgggcgggccgaatggcaatgcaccgaagcaggacaaa
tgccccggatacaccgccacttcggccgacgaaatgcttctggatgattcctgttcgtat
gcctccaacgaaattgccattaactggaatgccccgttggtttatctggcgacagctatc
gaggcattgcaaacaaagctttag

DBGET integrated database retrieval system