KEGG   Spirosoma linguale: Slin_5124Help
Entry
Slin_5124         CDS       T01156                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sli  Spirosoma linguale
Pathway
sli00500  Starch and sucrose metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Slin_5124
Enzymes [BR:sli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Slin_5124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-GeneID: 8728890
NCBI-ProteinID: ADB41096
UniProt: D2QGS4
Position
complement(6265906..6267483)
Genome map
AA seq 525 aa AA seqDB search
MLQQRSSGLLLHITSLPSAHGVGDLGPEAYRFADFLEASGQTYWQILPLTPVDPGSGFSP
YSSPSAFAGNILMISLEKLSDENLLSGDDLAVFNEQPIRTVSVTEPSSADGDTGITPALS
LSAPSTLHAAWIKKQPLLTQAAKTFLRDATPAQRSDYDRFCAWQADWLNDYALFTALQES
TKEPVWVRWPTEIVRRNPDALARQATLLQDEIEVIKVLQYFFLRQWNELAAYCYTRKIHL
IGDIPIYVQFNSADVWANPELFKLDENFQPLFVAGAPPDYFSEDGQRWGNPIYDWAEHER
TGFVWWMRRLRHQMSLYSLTRLDHFLGFAVYWEIPASEPTAKVGEWVKAPIESFMHAMHR
QFVQLPIIAEDLGAKAADIQPYLRHYGIPGMRVVQFGFGADMPTSTYAVHNHAENFVVYS
GTHDNNTTLGWFRELDKLHRQRMNDYLGIKVTDKNVVDQVCRLTMQSVARLAIMPIQDVL
NLDETHRMNTPGLGGRSWQWRLQPNQLTDEVAAKLLRLTKMTGRG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaacaacgctcaagtggtttactgcttcatattacttcgttaccctcggcgcat
ggcgtcggcgatttaggccccgaagcgtatcggttcgccgatttcctggaagcttccggg
caaacctactggcagattttaccactcacacccgttgatcccggttccggattctctccg
tacagcagcccatcagcctttgccgggaatatattgatgatcagtctggagaaactgtcc
gacgaaaatttattaagtggcgacgatctggcagtatttaacgagcaacctatccgtact
gtaagcgttacagaaccttcgtctgccgatggcgatactggtataacacccgcattgagt
ctgtcggcaccctccaccctccacgcggcctggattaaaaaacagcctctgctaacccag
gcggctaaaacatttttgcgggatgccacacccgcccagcgcagcgattatgatcgattc
tgcgcctggcaggccgactggctgaatgattacgcgctctttacggctttgcaggagtca
acgaaggagcccgtatgggtacgctggcctactgaaattgtgcgccgtaatccggacgct
ctggctcggcaggctaccttgttacaggatgagattgaggtcattaaagtacttcagtat
ttctttttgcggcaatggaatgaactagccgcttattgctacacccggaagattcacctg
attggcgatatcccgatctacgttcaatttaacagcgcggatgtgtgggcaaacccggag
ctgtttaagctggacgaaaattttcagccgttatttgttgccggtgctccgccggattat
ttcagtgaggatggacagcgctggggtaatcccatttatgattgggctgagcacgaacgc
actggctttgtctggtggatgcgtcggctgcggcatcagatgtcgctctacagcctgacc
cggctcgaccattttctgggcttcgccgtgtactgggaaattccggccagcgaaccaacg
gctaaagtgggtgagtgggtcaaagcacccatcgagtcattcatgcatgccatgcaccgg
cagttcgttcagcttcccattattgccgaagatctgggagcgaaagccgccgatattcag
ccttatctacggcattatggtataccgggtatgcgagtagttcagtttggcttcggtgcc
gatatgcctacctcgacgtatgcggtacataatcatgccgaaaactttgtcgtttattcc
ggcacgcacgacaacaacacaaccttgggctggtttcgggagctggacaagctccatcgc
cagcggatgaacgattacctggggattaaagtaaccgataagaatgtagtcgatcaggtg
tgtcggctcacgatgcagtcggtggctcgtctggccattatgcccattcaggatgtgttg
aacctcgatgaaactcaccggatgaacacgccaggtctgggtgggcgaagctggcaatgg
cgactgcaacccaaccaactgaccgatgaagtggcggctaaactgctgcggctcacaaag
atgaccggcagagggtag

DBGET integrated database retrieval system