KEGG   Spirosoma linguale: Slin_5162Help
Entry
Slin_5162         CDS       T01156                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sli  Spirosoma linguale
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sli00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6302336..6302965
Genome map
AA seq 209 aa AA seqDB search
MFIEPSRRREPPHLRTGWIEVICGSMFSGKTEELIRRLTRAQIAKLNVKIVKPALDTRYH
DENIVSHSSITISSVPVQTAGQILALAGNCDVVGIDEAQFFDQDITNVCTQLANQGKRVI
VAGLDMDFAGKPFGCMPQLLSIAEYVTKVHAICVVCGDIAQYSYRLVPSKERVLLGETDS
YEARCRRCFNLGNDAGRKEWAYEDIANDE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaccctctcgtcggcgcgaaccaccccaccttcgtaccggatggatagaa
gtgatatgtggctcgatgttctctgggaaaacggaagaattaattcgcaggctcacccgc
gcccagatagcgaaactgaatgtcaaaatcgttaaacccgctctcgacactcggtatcat
gatgaaaatatcgtctcgcattcgtcgatcacgatttcctctgttcccgtgcaaacagcg
ggccagattttagcgttagccgggaattgtgacgtagttggtattgatgaagcccaattt
tttgatcaggacatcacaaatgtgtgtacacagttggccaatcagggaaagcgggttatc
gttgccgggctggatatggattttgccggtaagccattcgggtgtatgcctcaattgctc
agcattgctgaatacgttacgaaagtccatgccatttgcgtagtctgtggcgacatagcc
caatactcataccggctggtgccctccaaagagcgtgtgttgctgggcgaaacagacagt
tacgaagcccgatgccgacgatgttttaaccttggcaatgatgcgggccggaaagagtgg
gcttacgaagatatagcgaatgatgaatga

DBGET integrated database retrieval system