KEGG   Spirosoma linguale: Slin_5386Help
Entry
Slin_5386         CDS       T01156                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sli  Spirosoma linguale
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slin_5386
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Slin_5386
Exosome [BR:sli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Slin_5386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6545989..6546972)
Genome map
AA seq 327 aa AA seqDB search
MNLIRRPRRNRQSAVIRDMVQETRLSVTDFILPVFIMEGQNLRSEVSSMPGIYRYSLDLL
LNEIQECVDLGVKTFDLFPNLPESRKDKYATESYNPDGLYPTAIRAIKERFPEVVIMTDV
AMDPYSSDGHDGIVENGKILNDPTLEVLGKMALAQAQAGANIIGPSDMMDGRVGYLRQVL
DEGGFHDVAIMSYAAKYASAFYGPFRDALDSAPKFGDKKTYQMNPANSREALIEAQLDFE
EGADFLMVKPALAYLDIIKLLNDNFHLPIAAYNVSGEYAMIKAAAQNGWLDGERAMMESL
MAIKRAGANVILTYFAKEAARYLLKNN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaatacgtcgcccgcgtcggaaccgccaatcggccgttatccgcgacatggta
caggaaacccgcctgtcggtcactgattttattttgccggtcttcattatggaaggccag
aacctccgttcggaagtatcgtctatgccgggtatttatcggtactcgctggatctgctg
ctcaacgaaattcaggagtgcgtagaccttggggttaaaacgttcgacctctttcctaac
cttcccgaatcccgcaaggacaagtacgccacggaaagctataaccccgatggcctgtat
ccgaccgccatccgggctattaaagagcgctttcccgaggtggttatcatgaccgacgtt
gccatggacccctatagttccgacgggcacgatggcatagtggaaaacggaaaaatcctg
aacgacccaacgcttgaggtattgggtaaaatggctttggctcaggcgcaggcgggtgcc
aacattattggtccgtcggatatgatggatggccgcgtgggctatttgcgtcaagtgctg
gatgaaggtggttttcacgacgttgccattatgtcgtatgccgctaagtacgccagtgct
ttttatggcccttttcgcgacgccctagactcggcgccgaagttcggtgataaaaaaacg
taccagatgaaccccgccaacagccgggaagccctcattgaagcccagctcgacttcgaa
gagggagccgatttcctaatggtaaaacctgctttagcttatctggacattattaaactg
ctgaatgataatttccatctgcccattgcagcctataacgtgagtggcgagtatgccatg
atcaaggcagcagcgcagaacggctggctcgacggagaacgcgctatgatggagtcactg
atggctattaagcgggcgggggctaacgttattttgacgtattttgctaaggaagcagcc
cgctatttgttgaaaaataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system