KEGG   Spirosoma linguale: Slin_5475Help
Entry
Slin_5475         CDS       T01156                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sli  Spirosoma linguale
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slin_5475
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slin_5475
Enzymes [BR:sli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Slin_5475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6661772..6662581
Genome map
AA seq 269 aa AA seqDB search
MTILDQIIAQKRIEVAERKAITTIQALEQMPDFRRETLSARDAIQDLHSTGIIAEFKRKS
PSKGIINDRADVATTTQGYVKSGAAVLSVLTDEPFFGGTSADLQAARLANPGTPILRKDF
IVDRYQLIEAKAWGADVVLLIAACLTPEEITELSMQAHDLSLQVLLEVHDEEELDRSLNY
NIDLVGVNNRDLKTFTTSIETSLRLIDKIPDTFAKITESGLHDADTMLTLFRAGFDGFLI
GEAFMKTDDPAKALADLVTQYSINNTLTL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcttgaccagatcattgcccagaagcgcatcgaagtagccgagcgcaaagcc
atcaccaccattcaggcgctggaacaaatgcccgactttcgacgggaaaccctgtcggca
cgggatgccattcaggatttacactcgacgggcatcattgccgagttcaaacgtaaatcg
ccttccaaaggtatcatcaacgaccgggccgacgtcgccaccactacgcagggctacgta
aaatcgggagccgccgtattgtccgttctaaccgacgagccgttttttggcggtacatcc
gccgatttacaggccgcccggctcgctaatcccggaacgccgattcttcgtaaagacttt
atcgttgaccgctaccaactgatcgaagccaaagcctggggtgccgatgtggtgctattg
attgcggcctgcctgacacctgaggaaattacggaactcagtatgcaggcgcacgatttg
agcctgcaggtgttgctggaagtacacgacgaggaggagctcgaccgctctctgaattat
aacatcgatctggtgggcgttaataaccgcgacctcaaaacgtttaccacatccatagaa
acgtcgctgcgattgattgataaaattccggacaccttcgccaagattaccgaaagcggt
ttgcacgatgcagataccatgctgacgctgttccgggcgggattcgacggttttttgatt
ggcgaagcgttcatgaaaacggacgacccagccaaagccctcgctgatttagttacgcaa
tactccatcaataacacactaacgctttaa

DBGET integrated database retrieval system