KEGG   Spirosoma linguale: Slin_5479Help
Entry
Slin_5479         CDS       T01156                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sli  Spirosoma linguale
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slin_5479
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5479
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slin_5479
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slin_5479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6663934..6665133
Genome map
AA seq 399 aa AA seqDB search
MQTTLEPQTSFEVSDKGFYGHFGGAFIPEMLYPNVEELRQNYLNIIADPDFQAEFWQLLE
EYVGRPTPLFLAKRLSAHIGATIYLKREDLCHTGAHKINNTIGQILVAQRLGKKRIVAET
GAGQHGVATATVCALMGLECIVYMGSIDMERQKPNVDRMRMLGAKVVPATSGSQTLKDAT
NEAMRHWINNPVDTHYIIGSVVGPHPYPDMVARFQSVISEEVKKQLFAKTGSENPDYMVA
CVGGGSNAAGAFYHYLNEPSVRLVAAEAAGQGISTGHSAATTALGKPGVLHGSRTILMQT
EDGQVTEPYSISAGLDYPGIGPLHAHLFESGRGDFYAITDDEALQAGFQLSKLEGIIPAL
ETSHALAALEKMNLNPDDVVVVCLSGRGDKDLSTYSKFL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccactcttgaaccacaaacctcattcgaggtatcagataaaggcttttatggc
cacttcggtggagcgttcattcccgaaatgctctatccaaacgtcgaagaacttcggcag
aattacctgaacatcatagccgatccggatttccaggccgagttctggcagttgctcgaa
gagtacgttggccggccaacgccgttgtttctggcgaaacgtctgtctgcgcacatcggg
gctacaatctacctcaaacgcgaagacctttgccataccggcgcgcataagatcaacaac
accatcgggcagattctggtagcgcagcggctcggtaagaagcgtatcgtggccgaaacg
ggtgccggtcagcatggcgtggcaacggcaacagtttgtgcgctgatggggctggagtgc
atcgtctacatgggcagcatcgacatggagcggcaaaaacccaacgtcgaccggatgcgg
atgctgggagctaaggtggtaccggctacgtcgggtagccagacgctgaaagacgcgacc
aatgaagctatgcgtcactggatcaacaaccctgtcgatacgcattacatcatcggttcg
gtggtggggcctcacccctacccggatatggtggcgcggtttcagtcggtcatttccgaa
gaagtaaagaagcagttgttcgccaaaacgggcagcgagaaccccgattacatggtcgcc
tgcgtaggtggaggtagcaatgccgccggtgcgttctaccattacctgaacgagccaagt
gttcgactggtagctgccgaagccgccggtcagggtatcagcacggggcattcggccgcc
actacggcgctgggcaaacctggtgtgttgcatggaagccgtaccatcctgatgcaaacg
gaagatggtcaggtaacggagccgtattcgatttcggccggtctggattatccaggcatc
ggcccgctccatgcgcacctgttcgaatcgggtcggggcgatttctacgccattacggac
gatgaagccctacaggctggtttccagcttagtaagctcgaaggcatcattccggcactg
gaaacatcccacgcgctggcggctctggagaaaatgaacctcaaccccgacgatgtcgtg
gtggtttgcctctccggccgtggcgataaagatctaagcacgtattcgaaatttttgtag

DBGET integrated database retrieval system