KEGG   Spirosoma linguale: Slin_5480Help
Entry
Slin_5480         CDS       T01156                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sli  Spirosoma linguale
Pathway
sli00260  Glycine, serine and threonine metabolism
sli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01130  Biosynthesis of antibiotics
sli01230  Biosynthesis of amino acids
Module
sli_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5480
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slin_5480
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slin_5480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA WD40_3 VWA
Motif
Other DBs
NCBI-GeneID: 8729248
NCBI-ProteinID: ADB41446
UniProt: D2QFY3
Position
6665276..6666112
Genome map
AA seq 278 aa AA seqDB search
MTQSLTQQQPTETVEATQNRITSLFSQKSERLLNVYFTAGYPTLNDTTTVLRGLQAAGVD
IVEIGMPYSDPVADGETIQQSNGVALDNGMSIKTLFAQLAGCRTDAENPITVPILLMGYI
NPVLQFGVENFCQKCQEVGVDGVILPDLPLDLFLEEYAPTFRKYGILNVHLITPQTTDAR
IRFIDAESDGFIYMVSSASITGSVKGVSDTMKAYFERIQGMNLRNPRLIGFGINNHETFD
TACAFANGAIVGSAFIRHLSEKGTSSESIRSFVETIRS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatccttaacccagcagcagccaaccgagacggttgaagctactcaaaaccgc
attaccagcctgttctcgcagaaaagcgagcggctgctgaacgtttattttaccgccgga
tacccaacccttaacgatacgacaaccgtccttcgtggcttacaggctgcgggcgtggac
atcgttgaaattggcatgccctactccgaccctgttgccgatggcgaaaccattcagcag
agcaacggcgtcgcgctcgacaacggtatgtcgatcaaaacgcttttcgcccagttggcc
ggttgtcggacagatgccgaaaatccaattacggttcccattctgctgatgggctacatc
aatcccgtccttcagtttggtgtggaaaatttctgccagaagtgccaggaggtgggcgtc
gatggggttattttgcccgacctcccgctggatttgtttctggaagaatacgctcccact
ttccggaagtacggcatcttgaacgtacacctcattacgccccaaactaccgacgcccgc
attcgattcatcgacgcagagtcagacggctttatttacatggtttcgtcggctagcatt
accggctcggtgaaaggcgtgagcgacaccatgaaggcgtatttcgagcggattcagggc
atgaacctgcgtaacccgcgtctgatcggcttcggtatcaacaaccacgagacgttcgat
acggcctgtgcgtttgcgaacggtgccattgtgggtagcgcgttcatccggcatctgtct
gaaaaaggcacatcgtctgagagcattcgctcgtttgtagaaacgattcggtcgtaa

DBGET integrated database retrieval system