KEGG   Spirosoma linguale: Slin_5480Help
Entry
Slin_5480         CDS       T01156                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sli  Spirosoma linguale
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slin_5480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5480
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slin_5480
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slin_5480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6665276..6666112
Genome map
AA seq 278 aa AA seqDB search
MTQSLTQQQPTETVEATQNRITSLFSQKSERLLNVYFTAGYPTLNDTTTVLRGLQAAGVD
IVEIGMPYSDPVADGETIQQSNGVALDNGMSIKTLFAQLAGCRTDAENPITVPILLMGYI
NPVLQFGVENFCQKCQEVGVDGVILPDLPLDLFLEEYAPTFRKYGILNVHLITPQTTDAR
IRFIDAESDGFIYMVSSASITGSVKGVSDTMKAYFERIQGMNLRNPRLIGFGINNHETFD
TACAFANGAIVGSAFIRHLSEKGTSSESIRSFVETIRS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatccttaacccagcagcagccaaccgagacggttgaagctactcaaaaccgc
attaccagcctgttctcgcagaaaagcgagcggctgctgaacgtttattttaccgccgga
tacccaacccttaacgatacgacaaccgtccttcgtggcttacaggctgcgggcgtggac
atcgttgaaattggcatgccctactccgaccctgttgccgatggcgaaaccattcagcag
agcaacggcgtcgcgctcgacaacggtatgtcgatcaaaacgcttttcgcccagttggcc
ggttgtcggacagatgccgaaaatccaattacggttcccattctgctgatgggctacatc
aatcccgtccttcagtttggtgtggaaaatttctgccagaagtgccaggaggtgggcgtc
gatggggttattttgcccgacctcccgctggatttgtttctggaagaatacgctcccact
ttccggaagtacggcatcttgaacgtacacctcattacgccccaaactaccgacgcccgc
attcgattcatcgacgcagagtcagacggctttatttacatggtttcgtcggctagcatt
accggctcggtgaaaggcgtgagcgacaccatgaaggcgtatttcgagcggattcagggc
atgaacctgcgtaacccgcgtctgatcggcttcggtatcaacaaccacgagacgttcgat
acggcctgtgcgtttgcgaacggtgccattgtgggtagcgcgttcatccggcatctgtct
gaaaaaggcacatcgtctgagagcattcgctcgtttgtagaaacgattcggtcgtaa

DBGET integrated database retrieval system