KEGG   Spirosoma linguale: Slin_5480Help
Entry
Slin_5480         CDS       T01156                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sli  Spirosoma linguale
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slin_5480
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5480
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slin_5480
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slin_5480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6665276..6666112
Genome map
AA seq 278 aa AA seqDB search
MTQSLTQQQPTETVEATQNRITSLFSQKSERLLNVYFTAGYPTLNDTTTVLRGLQAAGVD
IVEIGMPYSDPVADGETIQQSNGVALDNGMSIKTLFAQLAGCRTDAENPITVPILLMGYI
NPVLQFGVENFCQKCQEVGVDGVILPDLPLDLFLEEYAPTFRKYGILNVHLITPQTTDAR
IRFIDAESDGFIYMVSSASITGSVKGVSDTMKAYFERIQGMNLRNPRLIGFGINNHETFD
TACAFANGAIVGSAFIRHLSEKGTSSESIRSFVETIRS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatccttaacccagcagcagccaaccgagacggttgaagctactcaaaaccgc
attaccagcctgttctcgcagaaaagcgagcggctgctgaacgtttattttaccgccgga
tacccaacccttaacgatacgacaaccgtccttcgtggcttacaggctgcgggcgtggac
atcgttgaaattggcatgccctactccgaccctgttgccgatggcgaaaccattcagcag
agcaacggcgtcgcgctcgacaacggtatgtcgatcaaaacgcttttcgcccagttggcc
ggttgtcggacagatgccgaaaatccaattacggttcccattctgctgatgggctacatc
aatcccgtccttcagtttggtgtggaaaatttctgccagaagtgccaggaggtgggcgtc
gatggggttattttgcccgacctcccgctggatttgtttctggaagaatacgctcccact
ttccggaagtacggcatcttgaacgtacacctcattacgccccaaactaccgacgcccgc
attcgattcatcgacgcagagtcagacggctttatttacatggtttcgtcggctagcatt
accggctcggtgaaaggcgtgagcgacaccatgaaggcgtatttcgagcggattcagggc
atgaacctgcgtaacccgcgtctgatcggcttcggtatcaacaaccacgagacgttcgat
acggcctgtgcgtttgcgaacggtgccattgtgggtagcgcgttcatccggcatctgtct
gaaaaaggcacatcgtctgagagcattcgctcgtttgtagaaacgattcggtcgtaa

DBGET integrated database retrieval system