KEGG   Spirosoma linguale: Slin_5522Help
Entry
Slin_5522         CDS       T01156                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sli  Spirosoma linguale
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slin_5522
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5522
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Slin_5522
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Slin_5522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6723406..6724713)
Genome map
AA seq 435 aa AA seqDB search
MRFYSTNSPSVTVSTEQALFQSMPADKGLYMPAPLPYLGADFFSAIADQSLADIGFAISQ
ALFGDEISKSDLEDLTHHAFPFSTPVIELEAGKVGVLELFHGPSLAFKDVGARYMAGLMS
YFSKQTDKEVNILVATSGDTGGAVAMGFHNVPGVRVSILYPSGRVSELQEKQLTTLGGNI
QAFEVNGSFDDCQAIVKQAFVDAELNAHLSLSSANSINIFRLIPQGFYYVSAFGQVRSSG
KPVVFSTPSGNFGNLSAGALVQKMGLPVSHFVAATNLNHVVPNYLKTGDYVPKASIATIS
NAMDVGSPSNFTRLSHLYDDRYDQFKANVSGYFFDDDETRAGMKRIYETYNYVSCPHTAI
GIMGLEKYLADTKQDITGVALATAHPSKFKPLVEEVLNVSVEVPDRLAELAQREKNSIRI
SANYADFKESFLQTV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttacagcactaatagtccgtctgttactgtctctaccgagcaggctttgttt
caaagtatgcctgctgacaaagggctttatatgcctgctccgctgccctatctcggcgct
gactttttttcggccattgcagatcaatcgttggctgacataggctttgctattagtcag
gcgttgtttggcgatgaaataagcaagtcagatttagaagatctaacacatcatgcgttt
cccttctctacaccagttatagaattagaggcaggtaaggttggggttttggagttgttt
cacggaccttcgcttgcgtttaaggacgtgggcgcccgttatatggcgggcttaatgtcc
tatttttcgaaacaaacggataaagaggtaaatattctggttgctacatcgggcgataca
ggtggtgctgttgctatgggttttcataacgttccgggtgttcgagtatctattctttat
cctagcggtcgagttagtgaattacaggagaaacaattgacaacgcttggtgggaatatc
caggcatttgaagtaaatggctctttcgacgattgtcaggccattgtaaaacaggctttc
gttgatgctgagttgaatgctcatctttctctgtcttcggccaattcaattaacattttc
cgtcttattccccaaggcttttattacgtgagtgcctttggtcaagtcagatcttccggt
aaacctgtagtgttttctactcctagtggtaacttcggaaatctgagtgctggcgcgctc
gtacaaaaaatgggattaccagtttctcattttgtagcggctactaacctcaaccatgtg
gttccgaactaccttaagacaggggactatgttccgaaagcatctatagctaccatttca
aacgccatggacgtaggaagcccgagtaattttacaaggctctctcatctatatgatgat
cgctacgatcagtttaaagccaacgtttcgggctacttttttgatgatgacgaaaccaga
gccgggatgaaacgtatttatgagacatacaactatgtatcctgccctcataccgctatt
ggtattatgggtttagaaaaatacctggctgataccaaacaagatattaccggtgttgct
ctagcaacagctcatccttcaaagtttaagccacttgtagaagaagttttaaatgtttcc
gttgaggttccagacaggcttgcagaattggcccagcgagaaaagaatagcattcgaatc
tctgcgaactatgctgattttaaagagtctttcttacagacagtgtaa

DBGET integrated database retrieval system