KEGG   Spirosoma linguale: Slin_5522Help
Entry
Slin_5522         CDS       T01156                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sli  Spirosoma linguale
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slin_5522
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5522
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Slin_5522
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Slin_5522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6723406..6724713)
Genome map
AA seq 435 aa AA seqDB search
MRFYSTNSPSVTVSTEQALFQSMPADKGLYMPAPLPYLGADFFSAIADQSLADIGFAISQ
ALFGDEISKSDLEDLTHHAFPFSTPVIELEAGKVGVLELFHGPSLAFKDVGARYMAGLMS
YFSKQTDKEVNILVATSGDTGGAVAMGFHNVPGVRVSILYPSGRVSELQEKQLTTLGGNI
QAFEVNGSFDDCQAIVKQAFVDAELNAHLSLSSANSINIFRLIPQGFYYVSAFGQVRSSG
KPVVFSTPSGNFGNLSAGALVQKMGLPVSHFVAATNLNHVVPNYLKTGDYVPKASIATIS
NAMDVGSPSNFTRLSHLYDDRYDQFKANVSGYFFDDDETRAGMKRIYETYNYVSCPHTAI
GIMGLEKYLADTKQDITGVALATAHPSKFKPLVEEVLNVSVEVPDRLAELAQREKNSIRI
SANYADFKESFLQTV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttacagcactaatagtccgtctgttactgtctctaccgagcaggctttgttt
caaagtatgcctgctgacaaagggctttatatgcctgctccgctgccctatctcggcgct
gactttttttcggccattgcagatcaatcgttggctgacataggctttgctattagtcag
gcgttgtttggcgatgaaataagcaagtcagatttagaagatctaacacatcatgcgttt
cccttctctacaccagttatagaattagaggcaggtaaggttggggttttggagttgttt
cacggaccttcgcttgcgtttaaggacgtgggcgcccgttatatggcgggcttaatgtcc
tatttttcgaaacaaacggataaagaggtaaatattctggttgctacatcgggcgataca
ggtggtgctgttgctatgggttttcataacgttccgggtgttcgagtatctattctttat
cctagcggtcgagttagtgaattacaggagaaacaattgacaacgcttggtgggaatatc
caggcatttgaagtaaatggctctttcgacgattgtcaggccattgtaaaacaggctttc
gttgatgctgagttgaatgctcatctttctctgtcttcggccaattcaattaacattttc
cgtcttattccccaaggcttttattacgtgagtgcctttggtcaagtcagatcttccggt
aaacctgtagtgttttctactcctagtggtaacttcggaaatctgagtgctggcgcgctc
gtacaaaaaatgggattaccagtttctcattttgtagcggctactaacctcaaccatgtg
gttccgaactaccttaagacaggggactatgttccgaaagcatctatagctaccatttca
aacgccatggacgtaggaagcccgagtaattttacaaggctctctcatctatatgatgat
cgctacgatcagtttaaagccaacgtttcgggctacttttttgatgatgacgaaaccaga
gccgggatgaaacgtatttatgagacatacaactatgtatcctgccctcataccgctatt
ggtattatgggtttagaaaaatacctggctgataccaaacaagatattaccggtgttgct
ctagcaacagctcatccttcaaagtttaagccacttgtagaagaagttttaaatgtttcc
gttgaggttccagacaggcttgcagaattggcccagcgagaaaagaatagcattcgaatc
tctgcgaactatgctgattttaaagagtctttcttacagacagtgtaa

DBGET integrated database retrieval system