KEGG   Spirosoma linguale: Slin_5522Help
Entry
Slin_5522         CDS       T01156                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sli  Spirosoma linguale
Pathway
sli00260  Glycine, serine and threonine metabolism
sli00750  Vitamin B6 metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01230  Biosynthesis of amino acids
Module
sli_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slin_5522
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Slin_5522
Enzymes [BR:sli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Slin_5522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 8729290
NCBI-ProteinID: ADB41488
UniProt: D2QG25
Position
complement(6723406..6724713)
Genome map
AA seq 435 aa AA seqDB search
MRFYSTNSPSVTVSTEQALFQSMPADKGLYMPAPLPYLGADFFSAIADQSLADIGFAISQ
ALFGDEISKSDLEDLTHHAFPFSTPVIELEAGKVGVLELFHGPSLAFKDVGARYMAGLMS
YFSKQTDKEVNILVATSGDTGGAVAMGFHNVPGVRVSILYPSGRVSELQEKQLTTLGGNI
QAFEVNGSFDDCQAIVKQAFVDAELNAHLSLSSANSINIFRLIPQGFYYVSAFGQVRSSG
KPVVFSTPSGNFGNLSAGALVQKMGLPVSHFVAATNLNHVVPNYLKTGDYVPKASIATIS
NAMDVGSPSNFTRLSHLYDDRYDQFKANVSGYFFDDDETRAGMKRIYETYNYVSCPHTAI
GIMGLEKYLADTKQDITGVALATAHPSKFKPLVEEVLNVSVEVPDRLAELAQREKNSIRI
SANYADFKESFLQTV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttttacagcactaatagtccgtctgttactgtctctaccgagcaggctttgttt
caaagtatgcctgctgacaaagggctttatatgcctgctccgctgccctatctcggcgct
gactttttttcggccattgcagatcaatcgttggctgacataggctttgctattagtcag
gcgttgtttggcgatgaaataagcaagtcagatttagaagatctaacacatcatgcgttt
cccttctctacaccagttatagaattagaggcaggtaaggttggggttttggagttgttt
cacggaccttcgcttgcgtttaaggacgtgggcgcccgttatatggcgggcttaatgtcc
tatttttcgaaacaaacggataaagaggtaaatattctggttgctacatcgggcgataca
ggtggtgctgttgctatgggttttcataacgttccgggtgttcgagtatctattctttat
cctagcggtcgagttagtgaattacaggagaaacaattgacaacgcttggtgggaatatc
caggcatttgaagtaaatggctctttcgacgattgtcaggccattgtaaaacaggctttc
gttgatgctgagttgaatgctcatctttctctgtcttcggccaattcaattaacattttc
cgtcttattccccaaggcttttattacgtgagtgcctttggtcaagtcagatcttccggt
aaacctgtagtgttttctactcctagtggtaacttcggaaatctgagtgctggcgcgctc
gtacaaaaaatgggattaccagtttctcattttgtagcggctactaacctcaaccatgtg
gttccgaactaccttaagacaggggactatgttccgaaagcatctatagctaccatttca
aacgccatggacgtaggaagcccgagtaattttacaaggctctctcatctatatgatgat
cgctacgatcagtttaaagccaacgtttcgggctacttttttgatgatgacgaaaccaga
gccgggatgaaacgtatttatgagacatacaactatgtatcctgccctcataccgctatt
ggtattatgggtttagaaaaatacctggctgataccaaacaagatattaccggtgttgct
ctagcaacagctcatccttcaaagtttaagccacttgtagaagaagttttaaatgtttcc
gttgaggttccagacaggcttgcagaattggcccagcgagaaaagaatagcattcgaatc
tctgcgaactatgctgattttaaagagtctttcttacagacagtgtaa

DBGET integrated database retrieval system