KEGG   Spirosoma linguale: Slin_5548Help
Entry
Slin_5548         CDS       T01156                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sli  Spirosoma linguale
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Slin_5548
Enzymes [BR:sli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Slin_5548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6757958..6758557
Genome map
AA seq 199 aa AA seqDB search
MDGKLIIFSAPSGSGKTTIVKHLLAENNNLGFSISACTRDRRGRAEENGKDYYFLTPEEF
KQRIDNDEFVEWEEVYVGAFYGTLKSEIERLWKSGKHVLFDVDVQGGLKLKEYYGDKALA
VFVKVPDEETLRQRLIGRGSETEESLSKRLFKVHFEMSFQDRFDVVLVNDDLETSLQKAQ
KLVDDFVRENKVPDKGAVV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtggacggtaaactgatcattttttctgccccttccggttcgggcaaaaccaccattgtc
aagcatttgctggccgagaataataatctcggcttttccatttcagcctgcacccgcgac
cgtcggggccgggccgaagagaatggcaaggattattacttcctcacaccggaagaattc
aagcagcgaatagataatgacgaattcgttgaatgggaagaggtctatgtaggcgcgttc
tacggaacccttaagtcagaaatcgaacggctctggaagagtggcaagcatgtattgttc
gatgtagatgttcagggaggactcaaactaaaagagtactacggcgataaggcactggcc
gttttcgtaaaagtacccgatgaggaaacgctgcgccaacgcctgattggccgcggctcc
gaaacagaagaaagcctatctaaacggctttttaaagttcacttcgaaatgagctttcag
gatcgcttcgatgtcgttctagtaaacgacgacctggaaacatcgctccaaaaagcccag
aagctggtcgatgatttcgtgagagagaacaaagtgcctgataagggcgcagttgtttaa

DBGET integrated database retrieval system