KEGG   Spirosoma linguale: Slin_5608Help
Entry
Slin_5608         CDS       T01156                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sli  Spirosoma linguale
Pathway
sli00010  Glycolysis / Gluconeogenesis
sli00051  Fructose and mannose metabolism
sli00562  Inositol phosphate metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
sli01230  Biosynthesis of amino acids
Module
sli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sli_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_5608
   00051 Fructose and mannose metabolism
    Slin_5608
   00562 Inositol phosphate metabolism
    Slin_5608
Enzymes [BR:sli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Slin_5608
Exosome [BR:sli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Slin_5608
  Exosomal proteins of bladder cancer cells
   Slin_5608
  Exosomal proteins of melanoma cells
   Slin_5608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8729382
NCBI-ProteinID: ADB41573
UniProt: D2QRZ1
Position
complement(6824968..6825732)
Genome map
AA seq 254 aa AA seqDB search
MRKKIVAGNWKMNKTADEAKALLSEVINMVKDEITGDVEVVLCPPALYLATARQYVTDGG
KVALGAQNCHEKVSGAYTGEISAPMLQSIGVEYVILGHSERRQYFGETNAQLAEKVNIAL
ENGLKPIFCCGESRDLRENGDYVAFVKDQITESLFHLSAESFANIVIAYEPIWAIGTGLT
ASSAQAQDMHFELRQHIAGQYGDAVAQDTTILYGGSANAQNAEELFARPDVDGGLIGGAS
LKSRDFLTVVKAAQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagaaaatcgttgccggaaactggaaaatgaacaagacagccgacgaagcaaaa
gccctgctatcggaggtaattaatatggttaaggatgagataacgggtgatgttgaagta
gtcctttgcccacccgcgctctacctggctactgcccggcaatacgtaaccgacggcggc
aaggttgcgttgggtgctcagaactgccacgagaaagtatccggtgcttatacgggcgag
atttcggcccctatgctccagtcaatcggggttgagtacgttattttgggccacagcgaa
cggcggcagtatttcggcgaaaccaacgctcaactagccgagaaagtaaatatcgcgctc
gaaaacgggctgaaacctatcttctgctgcggtgaatctcgtgatcttcgcgaaaacggt
gattatgtcgccttcgtaaaagatcagattacagagagcctttttcatctgtcggccgag
tcgtttgccaatattgtgatcgcctacgaacccatctgggcgattggtacgggcctgacg
gcttcgtcggcacaggcacaggacatgcacttcgaacttcgccagcatattgccggtcaa
tacggcgacgcggtagcgcaggacacaaccatcctgtacggcggcagcgccaacgcgcag
aacgccgaggagctattcgcccgtcccgacgtcgacggtggcctgattggtggcgcatcg
ctcaaatcccgcgatttcctgacggttgtgaaagcagcgcagtag

DBGET integrated database retrieval system