KEGG   Spirosoma linguale: Slin_6109Help
Entry
Slin_6109         CDS       T01156                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sli  Spirosoma linguale
Pathway
sli00071  Fatty acid degradation
sli00280  Valine, leucine and isoleucine degradation
sli00281  Geraniol degradation
sli00310  Lysine degradation
sli00362  Benzoate degradation
sli00380  Tryptophan metabolism
sli00410  beta-Alanine metabolism
sli00640  Propanoate metabolism
sli00650  Butanoate metabolism
sli00903  Limonene and pinene degradation
sli00930  Caprolactam degradation
sli01040  Biosynthesis of unsaturated fatty acids
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
sli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Slin_6109
   00650 Butanoate metabolism
    Slin_6109
  Lipid metabolism
   00071 Fatty acid degradation
    Slin_6109
   01040 Biosynthesis of unsaturated fatty acids
    Slin_6109
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Slin_6109
   00310 Lysine degradation
    Slin_6109
   00380 Tryptophan metabolism
    Slin_6109
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Slin_6109
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Slin_6109
   00281 Geraniol degradation
    Slin_6109
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Slin_6109
   00930 Caprolactam degradation
    Slin_6109
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Slin_6109
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Slin_6109
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Slin_6109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 2-Hacid_dh_C NAD_binding_2 F420_oxidored Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 8729890
NCBI-ProteinID: ADB42071
UniProt: D2QTD9
Position
complement(7405274..7407430)
Genome map
AA seq 718 aa AA seqDB search
MINYTVDQQIAIISWAMTSSPMNVLNDESIPEFEAALQRAFTDESVKGLIITSAKPEFVA
GADLKMILRANDKPPAEMLKVSSELNRVFRSIETSGKPTVAAINGTALGGGYEICLACHH
RVALNNPKTVIGLVEVTIGLLPGAGGTQRLPRMIGIQAALPLILEGRKVSVQEAKNLGMI
DDIADTPDEMMAQARAWIDANGTSAGQKPLKPWDEIDRKTGKIVGKDNFKVPGGNVQSPV
GAQTFAAGTAMLMDKTKGNYPAPLEIMACVYEGLQVNIDRALMIEARHFVKVATSKVAKN
LIQTMFLGMNEANKGASRPKDYPKTDVKKLGILGAGMMGAGIAYVSAQTGIEVILKDVSV
EAAEKGKDYSRNLLKKGVERGKVDPAKVDGILNLIKPTADVQDLQGCDLIIEAVFENREL
KAQVTREAEPMLAENGLGVFGSNTSTLPISGLAQASGKPENFIGIHFFSPVDKMMLVEII
MGQQTSDYALAVAIDFTRKIRKTPIVVNDARGFYTSRCFSTYSSEGMELLKEGVNPILIE
NAGKDAGMPVGPLAVTDEVALDLVYKITGQGIKDGAVREDDTSYQVARTFVELGRTGKKA
KAGFYDYQDDRSKKLWPGLQDLFPQAEQQPTLDEVKTRLLYRQAIEAVRCFEENVVRTKL
DADLGSILAWGFPAYTGGAVSFVDFVGVDTFVKTLDRLADQYGDRFLPTAALRERAQV
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgataaactacactgtcgaccagcagattgctatcatttcgtgggcgatgacctcctct
cccatgaacgttcttaacgacgaatcgatcccggaatttgaagccgccctccaacgtgcc
tttactgatgagtcggtgaagggcctgattattacctctgccaagcctgaattcgtagcc
ggtgccgacctcaaaatgatcctgcgcgctaacgataagcctcccgccgagatgctgaag
gtctcatcggagttgaaccgggtgttccggagcatcgaaacgtcgggcaagcctaccgtt
gccgccatcaacggtacggcgctggggggcggttacgaaatctgtctggcctgccaccac
cgcgtggctctcaataatccaaaaacagttatcggtctggttgaagtaacaatcggtttg
cttccgggcgcggggggcacccagcggctcccccgtatgattggtattcaggccgcttta
ccgcttattctggaaggtcggaaagtgagcgttcaggaagccaaaaacctcggtatgatc
gacgacattgccgacacacccgacgagatgatggcccaagcccgcgcctggatcgacgcc
aacggaacgtctgccgggcaaaaacccctgaagccctgggacgagattgatcggaagacg
gggaagatcgttgggaaagacaactttaaggtgccgggcggcaacgtccaaagccccgtt
ggtgcccagacgtttgcggctggaacggccatgctcatggataaaaccaagggtaactac
cccgcccccctcgaaatcatggcttgtgtgtacgagggtctgcaagtcaatatcgaccgg
gcactaatgatcgaagcgcggcattttgtgaaggtggcgacctcaaaagtggcgaagaac
ctcatccagacgatgtttctgggtatgaacgaagccaacaagggagccagccgtccgaaa
gattacccaaaaactgacgtaaagaagctggggattctcggtgcgggcatgatgggcgcg
ggcatcgcttatgtatccgctcagaccggcattgaggttatcctgaaagacgtatcggtc
gaagcggccgaaaaaggcaaagactattcccgaaacctgcttaaaaaaggcgttgaacgc
ggcaaagtcgacccggcgaaagtagacggcatcctgaacctgatcaaacccactgccgat
gtgcaggacttgcagggttgcgacctcattattgaagccgtctttgaaaaccgggagttg
aaagcgcaggtaacccgggaagccgaacccatgctggcagagaacgggctgggtgtcttc
ggttccaacacttccaccctgcccattagcggactggcgcaggcatcgggcaagccggag
aactttattggcattcacttcttctcgcccgttgataagatgatgcttgtggagattatc
atgggccaacaaacgtcggattatgcgctggccgtcgccatcgatttcacccgcaagatt
cgaaaaacaccaatcgttgtcaatgatgcccgaggcttttacacctcccgctgtttcagt
acgtattcatcggaaggaatggaattactgaaagagggagtcaaccccattctgatcgag
aatgccggaaaagacgccggaatgcccgttggcccactcgccgttacggacgaagttgcc
ctggatctggtctataaaattaccggacagggaattaaagacggggccgttcgcgaagac
gacaccagttaccaggttgccaggacgttcgttgaactgggccgaaccggtaaaaaggcc
aaagccgggttttacgattatcaggatgaccgaagcaagaagttatggccgggtttgcag
gacctgttcccacaggccgagcagcagcctacactcgatgaagtaaaaacgcgtttgctc
taccggcaggccatcgaagctgtccgctgcttcgaagaaaacgtggtacggacaaagcta
gatgctgatctcggttccattctggcctggggtttcccggcttatacgggtggggccgta
tcgtttgtggatttcgtgggtgtcgatacgttcgttaaaacgctggaccgcctagccgat
cagtacggtgatcggttcctcccaacggcggccctgcgcgaacgggcacaagtataa

DBGET integrated database retrieval system