KEGG   Spirosoma linguale: Slin_6500Help
Entry
Slin_6500         CDS       T01156                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sli  Spirosoma linguale
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Slin_6500
Enzymes [BR:sli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Slin_6500
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Slin_6500
Lipid biosynthesis proteins [BR:sli01004]
 Fatty acid synthase
  Component type
   Slin_6500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7885103..7885816
Genome map
AA seq 237 aa AA seqDB search
MKFCMNSKSLHSVISGLLLVLTVWGCGSSDTKTNDNATNAPTQQAKEKSDAPAKKQTVLF
YGNSLTAGYGVEPAQAFPALIGKKIDSLGLNYTVVNAGLSGETTAGGKSRIGWVLRQPVA
VFVLELGGNDGLRGLPLADTRQNLQAIMDTVRLKSPQATIVLAGMQIPPNMGTSYAKEFR
GLFKELADKNKAVLIPFLLENVGGIPKLNQPDGIHPTPAGHKIVANTVWQVLRPVLK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctgcatgaatagtaaatcactccattctgtgataagcggattgttgctggtc
ttaacggtctggggctgtggctcgtccgatacgaaaacgaacgacaacgccacaaatgca
cccacgcaacaggcaaaggaaaaatcggatgctccggccaaaaaacaaactgttctgttc
tacggaaatagcctgacggctggttatggggtggaaccggcgcaggcgtttccggctttg
atcggcaaaaagatcgactcgctcggcctgaattataccgttgtcaatgccggtttaagt
ggcgaaacgaccgccgggggcaaaagccggatcggctgggtgctgcgtcaacccgtagcg
gtgttcgttctggaactgggtggtaatgatggcctccgggggcttccgctggccgatact
cgccaaaatttacaggcgatcatggatactgtccggctgaagagcccgcaggctacaatt
gtgctcgccggtatgcagattccgcccaatatgggaacgagttacgccaaagaatttcgg
gggttgttcaaagaactggccgataagaacaaggccgtgctaattccctttttgctcgaa
aacgttggcggtattcctaaactgaaccagcctgatggtattcacccaacccccgccggg
cataagatcgtcgccaacacggtttggcaggttctccgaccggtattgaaatag

DBGET integrated database retrieval system