KEGG   Spirosoma linguale: Slin_6500Help
Entry
Slin_6500         CDS       T01156                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sli  Spirosoma linguale
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sli01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7885103..7885816
Genome map
AA seq 237 aa AA seqDB search
MKFCMNSKSLHSVISGLLLVLTVWGCGSSDTKTNDNATNAPTQQAKEKSDAPAKKQTVLF
YGNSLTAGYGVEPAQAFPALIGKKIDSLGLNYTVVNAGLSGETTAGGKSRIGWVLRQPVA
VFVLELGGNDGLRGLPLADTRQNLQAIMDTVRLKSPQATIVLAGMQIPPNMGTSYAKEFR
GLFKELADKNKAVLIPFLLENVGGIPKLNQPDGIHPTPAGHKIVANTVWQVLRPVLK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctgcatgaatagtaaatcactccattctgtgataagcggattgttgctggtc
ttaacggtctggggctgtggctcgtccgatacgaaaacgaacgacaacgccacaaatgca
cccacgcaacaggcaaaggaaaaatcggatgctccggccaaaaaacaaactgttctgttc
tacggaaatagcctgacggctggttatggggtggaaccggcgcaggcgtttccggctttg
atcggcaaaaagatcgactcgctcggcctgaattataccgttgtcaatgccggtttaagt
ggcgaaacgaccgccgggggcaaaagccggatcggctgggtgctgcgtcaacccgtagcg
gtgttcgttctggaactgggtggtaatgatggcctccgggggcttccgctggccgatact
cgccaaaatttacaggcgatcatggatactgtccggctgaagagcccgcaggctacaatt
gtgctcgccggtatgcagattccgcccaatatgggaacgagttacgccaaagaatttcgg
gggttgttcaaagaactggccgataagaacaaggccgtgctaattccctttttgctcgaa
aacgttggcggtattcctaaactgaaccagcctgatggtattcacccaacccccgccggg
cataagatcgtcgccaacacggtttggcaggttctccgaccggtattgaaatag

DBGET integrated database retrieval system