KEGG   Spirosoma linguale: Slin_6585Help
Entry
Slin_6585         CDS       T01156                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sli  Spirosoma linguale
Pathway
sli00010  Glycolysis / Gluconeogenesis
sli00052  Galactose metabolism
sli00500  Starch and sucrose metabolism
sli00520  Amino sugar and nucleotide sugar metabolism
sli00521  Streptomycin biosynthesis
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
sli01120  Microbial metabolism in diverse environments
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
Module
sli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sli_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slin_6585
   00052 Galactose metabolism
    Slin_6585
   00500 Starch and sucrose metabolism
    Slin_6585
   00520 Amino sugar and nucleotide sugar metabolism
    Slin_6585
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Slin_6585
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Slin_6585
Enzymes [BR:sli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Slin_6585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 8730371
NCBI-ProteinID: ADB42542
UniProt: D2QUR0
Position
complement(7996843..7997679)
Genome map
AA seq 278 aa AA seqDB search
MTIGVDLGGTNVRVGLVDNGILVRQRSMALEQKDSLQATLAQLIALIQPFADDSVNSIGI
GVPSVVDIDRGIVYNVANIPSWEEVALRDILEKEFDLPVFVNNDVNCFILGEHQFGLAKG
YRSAVGMSIGTGLGSGIIIDNQLYAGSNCGAGEIGLLPYLDKNIESYAATQFFESIHGTT
ALEASLSATLGDKNALSLWDDFGKHFGVAVKTVLYTYDPEVIILGGSIAKAYPFFRASMY
ESMADFAYPVTLRRLQIFQSQNENIALLGAAALVRQLV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggagttgacttaggcggaaccaatgtacgcgttggtctggtcgataatggt
atacttgttcgacagcgcagtatggcgctggaacaaaaagactcacttcaagctaccctg
gcgcagcttatcgcgcttatccagccctttgcggacgattctgtaaacagcatcggcatt
ggggtcccatcggtggtcgatattgaccgggggattgtctataatgtcgccaacatcccc
tcgtgggaggaagtggccctgcgcgatattctggaaaaagagttcgaccttcccgttttc
gtgaataacgatgtgaactgctttattctcggcgagcatcagtttgggctggctaaaggc
taccggtcggcggtgggcatgtccattggaacagggctggggtcgggcattatcatcgac
aaccagctatatgcgggcagtaactgcggagcgggcgaaatcgggctactgccgtacctc
gacaaaaatatcgagtcgtatgcggccacacagtttttcgaatccattcacggaacaacg
gcactggaggccagtctgtcggctaccctcggggataaaaacgcgctgagcctctgggat
gatttcggaaagcacttcggcgtggccgtaaaaacagtgctttacacctacgaccccgaa
gtgattatcctgggtggctccattgccaaggcgtacccatttttccgggcgtcgatgtac
gaaagcatggccgactttgcgtatccggttacgctacgtcggctacagattttccagtcc
cagaacgagaacatcgccctgctgggcgcggctgcactggtgcgccaactggtgtag

DBGET integrated database retrieval system