KEGG   Spirosoma linguale: Slin_6624Help
Entry
Slin_6624         CDS       T01156                                 

Definition
dihydroorotase
Orthology
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
sli  Spirosoma linguale
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Slin_6624
Enzymes [BR:sli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Slin_6624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8055778..8057082
Genome map
AA seq 434 aa AA seqDB search
MQLLIRSARIVDAASSFDGQVCDILVDNGLIRQIGNNLPIDANVRVAEADNLHVSLGWVD
MRVLTQDPGYEHKEDLTSVCRAAAAGGFTDIAVLPNTQPVVDAKGTLGYIQRMAEGQPVR
VHVIAAVTKKAAGEDFTEMLDLHHAGAVAFSDGNHPLQNPDLLLKTLQYLQPVNGLLMNR
PEETLLTRFGQMHEGIQSTLLGLKGIPALAEELMIERDLRLLDYVSAGQTETQEPECGFS
PALHFSTISTGRSVELIRQAKAKGSPVSCDVAAHQLVFDDSALSDFDTNLKVNPPFRSVD
DVRALWDGLKDGTIDAIVSDHTPHDPECKNLEFDQADFGIIGLETVFSNAVMHNQDLPLP
QLIEKLTTRPRQILRLPVTAIAEGQPATLTLFDPAGSWTYDRTFSKSKNSPFLGQTLTGR
VIGTVHRGQLTTTL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcctgattcgttctgcccgtattgttgatgctgcttcatcgttcgatggacag
gtatgtgatattctggttgataatggcctgattcgtcagattggcaacaacttgcctatt
gatgcgaatgtccgggtcgctgaagccgataatcttcatgtctccctcggttgggtcgat
atgcgcgtgctgacccaggaccccggttacgaacacaaagaagacctgaccagcgtgtgc
cgggccgcagccgccggtggatttaccgatattgctgtactgcccaacacgcagcccgtt
gtggatgccaaggggacgctgggctatattcagcggatggccgaggggcagccggtacgg
gtacacgtcattgccgctgtcacgaaaaaagccgctggtgaagattttacggaaatgctc
gacctgcaccatgcgggtgccgttgcgttttcggatggaaatcacccgcttcagaacccc
gatctgctgctcaaaacactccagtacttacagccggtcaatggcctgctcatgaaccgc
ccggaagaaaccctgctgacgcgtttcgggcagatgcacgagggcattcagagtacgctg
ctcggcctgaaaggcatacccgcgctggccgaagaactgatgatcgagcgcgatttgcgg
ctgctggattacgtgagtgcagggcagacggaaactcaggaacccgaatgcggattttct
cccgccttacacttctctactatttcaacgggccggtcggtggagttgatccggcaggcc
aaagcgaaagggagcccggtgagttgcgacgtggcggcccatcagctggtttttgacgat
tcggccttgtcggacttcgacacaaatctgaaagtaaacccgccattccgctcggtggat
gatgtgcgcgcgctctgggacggcctgaaagacggcaccatcgatgcgattgtatcggac
catacgccccacgatccggaatgcaaaaacctggaattcgaccaggccgatttcggtatt
atcggtctggaaacggttttctccaatgcggtcatgcataatcaggatttgcctttgccg
caactcatcgagaaactaaccacccggccccggcaaatactacgccttccggtaacggcc
atcgccgaggggcaaccagccaccctgacgctattcgaccccgcgggcagctggacgtac
gaccgtacgttctctaaatcgaaaaactcaccatttctgggccaaacgctcacgggccgc
gtaatcggcacggtgcatcgcggccaattgacgaccaccttatga

DBGET integrated database retrieval system