KEGG   Staphylococcus lugdunensis N920143: SLUG_02310Help
Entry
SLUG_02310        CDS       T01951                                 

Definition
(GenBank) 2-oxoacid dehydrogenases acyltransferase family protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00020  Citrate cycle (TCA cycle)
sln00620  Pyruvate metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Module
sln_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_02310
   00020 Citrate cycle (TCA cycle)
    SLUG_02310
   00620 Pyruvate metabolism
    SLUG_02310
Enzymes [BR:sln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SLUG_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: CCB52645
Position
250187..251476
Genome map
AA seq 429 aa AA seqDB search
MSQNIIMPKLGMTMTEGTVEEWFVAEGDDVNEGDSIATISSEKLTQDIEAPATGTLLKIE
VQAGEDAKVKGVLGIIGDADEATDNSSSSTESTNETADTSEHDQHETSTETAKDDAQSYS
TEKSTADVEKSPQHTRIFISPLARNMAEDKALDINRIKGTGGNARITKLDIQRVEAQGYD
YDDSKATETSVQTSKNVDVTNIGEGLNPMRKRIAQNMRESLANTAQLTLHRKVDADRLLD
FKDKLTVELNQADKDVKLTVTALLAKAVVLALKDYGAMNARYDNGELLEYEDVHLGIATS
LEEGLMVPVINEADTKSIGALAEEIKKTSQAVRDGHTDDVQLSGATFTITNMGTSGIEYF
TPILNLGETGILGVGALMKEVTLDGDSLRQVSRIPLSLTFDHQILDGADAAEFLKVLAKY
IENPYLLIL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaatatcattatgccaaagctaggtatgacaatgacagaaggtactgtagaa
gaatggtttgtcgctgaaggtgatgatgtcaacgaaggtgatagtatagcaaccattagc
tcagaaaaattaacccaagatattgaagcgccagcgacaggaacattgctaaaaatcgag
gttcaagcaggagaagatgctaaagttaaaggtgttcttggaatcattggtgatgcagac
gaagctacagataatagctcaagttcaactgagtcaacaaatgaaactgcagatacatca
gaacatgatcagcatgagacgtcaacggagacagcaaaagacgatgctcaatcttattca
acagaaaaatcaactgcagatgtggaaaaatcaccacaacacacgcgtatctttatttca
ccacttgcacgcaatatggctgaagacaaagcgttagatattaatcgcataaaaggcaca
ggtggaaatgcacgtattaccaaattagacattcaacgcgtagaagctcaaggttatgat
tacgatgacagtaaagctactgaaacatcagtccaaacaagtaaaaacgttgatgttact
aatattggagaaggattaaatccaatgcgtaagcgcatcgcacaaaatatgcgtgaaagt
ttagctaacacagcccaattaacattacatcgcaaagtagatgccgatcgtctacttgat
tttaaagacaaattaaccgttgaattaaatcaagcagataaagatgtgaaattaactgta
actgcactcttagctaaagcagttgtacttgccttaaaagactatggcgcaatgaatgca
cgctatgacaatggtgagctattggaatatgaggatgttcatttaggtattgcaacatca
ttagaagaagggctaatggtacctgttattaatgaagctgatacgaaaagcattggtgca
ctcgctgaagaaattaaaaaaacatctcaagccgtacgtgatggtcacacagatgatgtt
caattgagtggtgcaacattcaccatcacgaatatgggtacaagtggtattgaatacttt
acccctattcttaatctaggagaaacagggattttaggtgttggtgcattgatgaaagaa
gtcacattagatggtgatagtttgagacaagtgtcacgtattcctttaagtttaactttc
gatcatcaaatattagatggcgcagacgctgcagagttcttaaaagtattagcaaaatat
atcgaaaatccatatttacttattttataa

DBGET integrated database retrieval system