KEGG   Staphylococcus lugdunensis N920143: SLUG_03580Help
Entry
SLUG_03580        CDS       T01951                                 

Definition
putative peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sln01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sln00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388756..389976
Genome map
AA seq 406 aa AA seqDB search
MTVLSEQERIDILADIVNINTENNNEIEVCYYLKELLQRYDIESKIIEIEGKRSNLVAEI
GSGRPVIGISGHMDVVDAGDEAQWMYPPFELHEQDGKLYGRGTSDMKGGLAALVIAMIEI
KASNLLQQGTIRLLATAAEEKEMSGSMLFRDKGYVDDLDGLIIGEPSDHYINYANKGSMG
IKIKAKGVAAHSSLPNLGHNAIDDIIRYIQKIKEKYEDIKNNDNKHSLDVSPLIKDYFGD
KFNDKELRKLENVAEGLVIVNSIIYGGEQFNTVPESAYAEFNIRTIPEYDNEAIIQLFEE
TLYEVDQAQLSMEITTNHAPVYSNKDNLLVKSFTEYKDDLTVTALVGATDASELLKGIDN
VDLTIIGPGFMRQAHRANEYIDKQHYLDFIDLYQHVIVDYLNKKSN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgactgttttgtctgaacaggaaagaatagatattttagcagacatcgttaatatcaat
acagagaataataatgaaatcgaggtttgctactatttgaaagaattactacaacgttat
gacattgaatcaaaaataattgaaattgaaggtaaacgttcaaatttagtagctgaaatt
gggtcaggtagacctgtcattggtatatctggacatatggatgttgtagacgcaggtgat
gaagcgcaatggatgtatcccccgtttgaattacatgagcaagatgggaaattatatggg
cgtggtacatctgatatgaagggcggccttgctgcgttagtcattgctatgatagaaata
aaagcttctaatttgttacaacaaggtaccatccgtcttttagcaacagcagctgaagaa
aaagaaatgtcaggatcaatgttatttcgtgataaaggttacgttgatgatttggatgga
ttgattattggtgaaccaagtgatcattatataaactatgctaacaaaggttcaatgggt
attaaaattaaagctaagggtgttgccgcgcatagttcgttacctaatttaggacataat
gcaatagatgacataattagatatatacaaaaaatcaaagaaaaatatgaagatattaaa
aataatgataataaacattcattagacgtatcaccgctaattaaagattactttggtgat
aagtttaatgataaggagcttagaaaattagaaaatgttgctgagggtttagttatagtt
aactcaattatttatggtggggaacagtttaatacagtacctgaaagtgcatatgcagaa
tttaatatacgtacaattccagaatatgataatgaagcaatcatacaattgtttgaagaa
actttgtatgaagtggatcaggcacaattatcaatggaaatcactacgaatcatgcccct
gtttatagcaacaaagataatttgttagtgaagtcatttactgaatataaagatgattta
acagttacagcgcttgtcggtgcgacagatgcatcagaattattaaaaggtatagataat
gtagacttaaccattatcggtcctggttttatgcgacaagcacatcgagcgaatgaatat
atagataaacagcattatttagattttattgatttgtatcaacatgtcattgttgattat
ttaaacaaaaagagtaattaa

DBGET integrated database retrieval system