KEGG   Staphylococcus lugdunensis N920143: SLUG_03710Help
Entry
SLUG_03710        CDS       T01951                                 

Definition
(GenBank) putative AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00620  Pyruvate metabolism
sln00640  Propanoate metabolism
sln00680  Methane metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_03710
   00620 Pyruvate metabolism
    SLUG_03710
   00640 Propanoate metabolism
    SLUG_03710
  Energy metabolism
   00680 Methane metabolism
    SLUG_03710
Enzymes [BR:sln01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SLUG_03710
Lipid biosynthesis proteins [BR:sln01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SLUG_03710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCB52794
Position
405095..406687
Genome map
AA seq 530 aa AA seqDB search
MKQSSLLAPETYNIVSEIEKHVSDQDKNAIIYENGHNDPIAVTYADLMKQANQVGHVLLN
HGLKKGDKILIMMPRSISTYRIYIAALKLGIAIIPSSEMLRTKDLQYRISHGEIDAVITM
PEFIKEFLNIEEYTSLTKFVVAGHHEAWISIDDERLNQSEELDMAPTSRDDIAILSYTSG
TTGNPKAVTHTHGWGFAHMKMAPKHWLSIKEDDLVWATAAPGWQKWVWTPFLSIMGSGAT
AFVYNGKFNPTRYLELLQNFKINVLCCTPTEYRMMAKLSNLDKYDIHHLHSAVSAGEPLN
KEVVNQFEAHFGLTVRDGYGQTESTLLIGFLKDTKPRPGSMGKAIPGSDTTVVDDEGRQV
APGVKGNIGVPLDLPALFKGYYKDEARTKAAHAGKYYITGDLAHIDEDGYFWFEGRSDDI
IISSGYTIGPFEVEDALTHHPAVKECAVVASPHEIRGNIVKAFVILNEGYKASDDLVKTL
QDFTKKTVAPYKYPRAIEFVEDLPKTNSGKIRRVELRDAERQKYNQQFKQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatcaagtttattagcgccagaaacatataatattgtcagtgaaattgaaaaa
catgtttctgaccaagataaaaatgcaattatttatgaaaatggacataatgacccaatc
gcggtaacttatgcagacttaatgaaacaagctaatcaagtcgggcatgtgctgttaaat
catggtctcaaaaagggagataaaattttaatcatgatgccgcggtcaatctctacatat
agaatttatatcgctgcattaaagctcggtattgcaattattccaagttctgaaatgctg
cgtactaaagatttgcaatatcgtatttcgcacggagaaatagatgcggttattactatg
ccggaatttattaaagagtttttgaatatagaggagtatacatcattaactaaatttgtt
gtcgcaggacaccatgaagcatggatttctattgatgacgagcgcttgaatcaaagtgaa
gaattagatatggcaccaaccagtcgagatgatattgcgatactatcttatacgtccggt
acaacagggaatccaaaagcagttacacatacacatggttggggttttgctcatatgaaa
atggcacctaagcattggttaagtattaaagaagatgatctggtgtgggcaaccgctgca
ccaggttggcaaaaatgggtatggacacctttcctttctattatggggtcaggagctaca
gcatttgtttacaatggcaagtttaatcctactcggtacttagagctattacaaaatttt
aagattaatgtcttatgctgtacgccaacagagtatcgaatgatggctaaattatccaat
ttagataagtatgatattcatcatttacatagtgcagtatcagctggtgagcctttaaat
aaagaggttgttaatcagtttgaagcgcactttgggcttactgttcgtgatggctatggt
caaacagagagcacattattgattggatttttaaaagatacaaaaccacgcccaggttct
atgggtaaagcaattccaggtagtgacacaacagtagttgatgatgaaggacgccaagtt
gctcctggtgtgaaaggaaatattggtgtaccactagatttaccagcattatttaaaggt
tattataaagatgaagcgcgaactaaagccgcacatgctgggaagtattatatcactggt
gatttagcacatattgatgaagatggttatttctggtttgaaggacgcagtgatgatatc
atcatcagttctggttacacgattggaccttttgaagtagaagatgcattaactcatcat
ccagccgtaaaagaatgtgcagtggtagccagtccccatgaaatacgtggaaatatagtc
aaagcatttgttattttaaatgagggttataaagcaagtgatgacttagttaaaacattg
caagactttactaaaaagaccgttgcaccatataaatatcctagagcgattgaatttgta
gaagatttaccaaagaccaattccggaaaaattcgtcgtgtagaattgcgtgatgcagaa
cgtcaaaagtacaaccaacaatttaaacaataa

DBGET integrated database retrieval system