KEGG   Staphylococcus lugdunensis N920143: SLUG_03710Help
Entry
SLUG_03710        CDS       T01951                                 

Definition
AMP-binding protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sln01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sln00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sln00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sln00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sln00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405095..406687
Genome map
AA seq 530 aa AA seqDB search
MKQSSLLAPETYNIVSEIEKHVSDQDKNAIIYENGHNDPIAVTYADLMKQANQVGHVLLN
HGLKKGDKILIMMPRSISTYRIYIAALKLGIAIIPSSEMLRTKDLQYRISHGEIDAVITM
PEFIKEFLNIEEYTSLTKFVVAGHHEAWISIDDERLNQSEELDMAPTSRDDIAILSYTSG
TTGNPKAVTHTHGWGFAHMKMAPKHWLSIKEDDLVWATAAPGWQKWVWTPFLSIMGSGAT
AFVYNGKFNPTRYLELLQNFKINVLCCTPTEYRMMAKLSNLDKYDIHHLHSAVSAGEPLN
KEVVNQFEAHFGLTVRDGYGQTESTLLIGFLKDTKPRPGSMGKAIPGSDTTVVDDEGRQV
APGVKGNIGVPLDLPALFKGYYKDEARTKAAHAGKYYITGDLAHIDEDGYFWFEGRSDDI
IISSGYTIGPFEVEDALTHHPAVKECAVVASPHEIRGNIVKAFVILNEGYKASDDLVKTL
QDFTKKTVAPYKYPRAIEFVEDLPKTNSGKIRRVELRDAERQKYNQQFKQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatcaagtttattagcgccagaaacatataatattgtcagtgaaattgaaaaa
catgtttctgaccaagataaaaatgcaattatttatgaaaatggacataatgacccaatc
gcggtaacttatgcagacttaatgaaacaagctaatcaagtcgggcatgtgctgttaaat
catggtctcaaaaagggagataaaattttaatcatgatgccgcggtcaatctctacatat
agaatttatatcgctgcattaaagctcggtattgcaattattccaagttctgaaatgctg
cgtactaaagatttgcaatatcgtatttcgcacggagaaatagatgcggttattactatg
ccggaatttattaaagagtttttgaatatagaggagtatacatcattaactaaatttgtt
gtcgcaggacaccatgaagcatggatttctattgatgacgagcgcttgaatcaaagtgaa
gaattagatatggcaccaaccagtcgagatgatattgcgatactatcttatacgtccggt
acaacagggaatccaaaagcagttacacatacacatggttggggttttgctcatatgaaa
atggcacctaagcattggttaagtattaaagaagatgatctggtgtgggcaaccgctgca
ccaggttggcaaaaatgggtatggacacctttcctttctattatggggtcaggagctaca
gcatttgtttacaatggcaagtttaatcctactcggtacttagagctattacaaaatttt
aagattaatgtcttatgctgtacgccaacagagtatcgaatgatggctaaattatccaat
ttagataagtatgatattcatcatttacatagtgcagtatcagctggtgagcctttaaat
aaagaggttgttaatcagtttgaagcgcactttgggcttactgttcgtgatggctatggt
caaacagagagcacattattgattggatttttaaaagatacaaaaccacgcccaggttct
atgggtaaagcaattccaggtagtgacacaacagtagttgatgatgaaggacgccaagtt
gctcctggtgtgaaaggaaatattggtgtaccactagatttaccagcattatttaaaggt
tattataaagatgaagcgcgaactaaagccgcacatgctgggaagtattatatcactggt
gatttagcacatattgatgaagatggttatttctggtttgaaggacgcagtgatgatatc
atcatcagttctggttacacgattggaccttttgaagtagaagatgcattaactcatcat
ccagccgtaaaagaatgtgcagtggtagccagtccccatgaaatacgtggaaatatagtc
aaagcatttgttattttaaatgagggttataaagcaagtgatgacttagttaaaacattg
caagactttactaaaaagaccgttgcaccatataaatatcctagagcgattgaatttgta
gaagatttaccaaagaccaattccggaaaaattcgtcgtgtagaattgcgtgatgcagaa
cgtcaaaagtacaaccaacaatttaaacaataa

DBGET integrated database retrieval system