KEGG   Staphylococcus lugdunensis N920143: SLUG_04430Help
Entry
SLUG_04430        CDS       T01951                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLUG_04430 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    SLUG_04430 (thl)
   00640 Propanoate metabolism
    SLUG_04430 (thl)
   00650 Butanoate metabolism
    SLUG_04430 (thl)
  Lipid metabolism
   00071 Fatty acid degradation
    SLUG_04430 (thl)
   00072 Synthesis and degradation of ketone bodies
    SLUG_04430 (thl)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLUG_04430 (thl)
   00310 Lysine degradation
    SLUG_04430 (thl)
   00380 Tryptophan metabolism
    SLUG_04430 (thl)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLUG_04430 (thl)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLUG_04430 (thl)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SLUG_04430 (thl)
Enzymes [BR:sln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SLUG_04430 (thl)
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLUG_04430 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
487855..489009
Genome map
AA seq 384 aa AA seqDB search
MRNIAIVSAKRTPIGRYKGKLRDYSAVELGTAALKAAVEAIDIDPSTIQQVIFGNVLQSG
VGQNPARQIAIKAGLPNTTPAMTINEVCGSGLKAIILGKQLIQLGEAKVVAVGGVESMTN
APQLILKEGQDPVESFMHDGLTDAFHYVPMGVTAENIAEKYHISREMQDAFANQSQQKAH
QATINGKFNNEIVPLIDAEGNEMTSDEGIRANSSVEKLATLKTIFKEQGTVTGGNASSIN
DGSSALILMEESYAKAHGFEILGLIGDYAEVGCDPQYMGYAPFYAVEKLLEKTQRHIDQV
DIVEMTEAFAAQSIPVKDNLHIPDDKLNIYGGAIALGHPIGASGARLVTTLVNALAQEEK
QTGVATACIGGGLGIALMIEKGES
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatattgcaatcgttagtgctaaacgcacaccaattggaagatacaaaggtaag
ttacgagactattcagcagttgaactaggaacagcagctttaaaagcagcagtagaagct
attgatattgatccaagtacaattcaacaagtcatttttggtaacgttcttcaaagtggg
gttggtcaaaatccagcacgtcaaattgctattaaagctgggttacctaacacgacaccg
gcaatgacaataaacgaggtatgtggttcaggccttaaagcaattattttaggcaagcaa
ttaatacaattaggcgaagcaaaagttgtggcagttggtggtgttgaaagtatgacaaat
gcaccacagttgattttaaaagaaggacaagaccctgtagaaagttttatgcatgatggt
ttaaccgatgctttccattatgttccaatgggtgtgactgctgaaaacattgcagaaaaa
tatcatattagtcgagaaatgcaagatgcgttcgctaatcaatcacaacaaaaggcgcat
caggctacaataaatggaaaatttaataatgaaatagtgcctctaatcgatgctgaaggt
aatgaaatgacttcagatgaaggtattcgtgctaatagtagtgttgagaaattagctacg
ttaaaaacaatatttaaagagcaaggtacggtcacaggtggcaatgcttctagtataaat
gatggatcgtctgcacttatcttgatggaagaaagttatgctaaagcacatggattcgag
atacttggcttgataggtgactacgctgaagttggttgcgatccacaatatatgggctat
gctccattctatgctgttgaaaaattattagaaaaaactcagcgtcatattgatcaagta
gatattgtagaaatgacagaggcgtttgcagcacaaagtattccagttaaagataatttg
catattccggatgataaattaaatatatatggtggtgcaattgcacttggtcatccgatt
ggcgcaagtggtgcaaggttagtgacaacattggtaaacgcattggcgcaagaagaaaag
caaacgggtgtagctactgcttgtattggtggcggcctaggtattgcgctaatgattgaa
aaaggggaatcataa

DBGET integrated database retrieval system