KEGG   Staphylococcus lugdunensis N920143: SLUG_04900Help
Entry
SLUG_04900        CDS       T01951                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00030  Pentose phosphate pathway
sln00051  Fructose and mannose metabolism
sln00680  Methane metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Module
sln_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_04900
   00030 Pentose phosphate pathway
    SLUG_04900
   00051 Fructose and mannose metabolism
    SLUG_04900
  Energy metabolism
   00680 Methane metabolism
    SLUG_04900
Enzymes [BR:sln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SLUG_04900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: CCB52929
Position
complement(540953..542917)
Genome map
AA seq 654 aa AA seqDB search
MTPNTLSELKQKYLDLLSHHYDSPEKLATEIINLESILELPKGTEHFVSDLHGEYDSFQH
VLRNGSGNVRAKINDIFKDKLTTKEINDLAALVYYPEEKLKLIKNEFNSRGQLNLWYITT
IERLIELITYCSSKYTRSKLRKALPTQYVYIVEELLYKSNEFNNKKSYYETLVNQIIELE
QSDDLIIGLSYTIQRLVVNHLHVVGDIYDRGPQPDKIMDTLIDYHSVDIQWGNHDVLWIG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEAYYDGNNPAFKPKKRPDKK
AALTKLEEDQITKIHQAIAIIQFKLEIPIIKRRPNFEMEERLVLEKTDYDNNKITVYGKT
YPLTNTCFTTVDPQNPGQLLPEEEDVINKLLLSFQQSEKLKRHMSFLMQKGTLYLPYNGN
LLIHGCIPVDENGEMEAFEIEGVKHQGRDLLDVFETHVREAFDHKDITDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIEDKVSHKEEKNPYYHLREDVDMIRKMLKDFGLNPDEGRI
INGHTPVKEIDGEDPIKADGKMLVIDGGFSKAYQKTTGIAGYTLLYNSFGMQLVAHQEFN
TKDKVLSDGADELSVRRVVDEELQRKKIRDTNDGYHIQEQIDILKTLMHDRYLN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgaatacactaagtgaacttaagcaaaagtatttagatttactttcccatcat
tacgatagcccagaaaaattagcaactgagattattaatttagagtctattttagaatta
ccaaaaggcacggaacactttgtcagtgatttacacggtgaatatgattcgttccaacat
gtattgcgcaatggttcaggcaacgtacgcgcgaaaataaatgatatctttaaagataaa
ttaaccactaaagaaattaatgatttagctgcccttgtttattatcccgaagaaaagtta
aagctaattaaaaatgaatttaattctagaggacaactcaatctgtggtatatcactacg
attgaacgcctaattgaacttattacatactgttcttctaaatatacacgttcaaaattg
cggaaagctttaccgacgcaatatgtctacattgttgaagaactattgtacaaaagcaat
gaatttaataacaaaaaatcttattatgaaacactcgtgaaccaaattattgaacttgaa
caatcagatgatttaattatcggtttatcttatacaattcaacgattagtcgtaaaccat
ctccatgttgttggtgacatttatgaccgtggacctcaaccagataaaattatggataca
cttatcgattatcattctgtcgatatccaatggggtaatcatgacgtattatggattggt
gcctatgccggttcaaaggtgtgtttagccaacttacttcgcatttgcgcgcgttatgat
aacttagatattatcgaagatgcatatggcattaatttacgaccgttactcactcttgcg
gaagcctattatgacgggaacaatcctgctttcaagcctaaaaaacggccggataaaaaa
gctgctttaacgaaactagaagaagatcaaataacaaaaatacatcaagcgattgccata
atccaattcaaattagaaatacctattattaaacgacgtccaaactttgaaatggaagag
cgtctcgtgcttgaaaaaacagattatgacaacaacaagattactgtgtatggtaagacc
tacccattaacaaatacgtgctttactactgtggatccacaaaatcctggtcaattgtta
cctgaagaagaagatgttattaataagctgttattgtcattccaacaatcagaaaaatta
aaacgtcatatgtcatttttaatgcaaaaaggtacattatatctcccttataacggtaat
ttactcatccatggctgtattcctgttgatgaaaatggagaaatggaagcttttgaaatt
gaaggtgtgaaacatcaaggacgtgatttactagatgtatttgaaacgcatgtacgtgaa
gcatttgaccataaggatattacagacgacttatctactgacctagtgtggtatttatgg
actggtaaatatagttcattatttggtaaacgtgccatgacaacatttgaacgttatttt
attgaagataaggtctcacataaagaagaaaagaacccttattatcacctacgtgaagat
gtggacatgattcgtaaaatgttaaaagactttggtctgaatcctgatgaaggacgtatt
atcaatgggcatacacctgttaaggaaattgatggagaagacccaattaaagctgatggt
aaaatgcttgtaattgatggtggtttctcaaaagcctatcaaaaaactacaggtattgct
ggctatacattattatacaattcattcggtatgcagcttgttgctcaccaagaatttaat
acgaaagataaagtactatctgatggggctgatgaactatctgtacgtcgagtcgtagat
gaagagctacaacgcaaaaaaatacgtgataccaatgatggttaccatattcaagaacaa
atcgatattctcaagacattaatgcatgatcgctatcttaattag

DBGET integrated database retrieval system