KEGG   Staphylococcus lugdunensis N920143: SLUG_04900Help
Entry
SLUG_04900        CDS       T01951                                 

Definition
hypothetical protein
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sln01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sln00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sln00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sln00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sln00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(540953..542917)
Genome map
AA seq 654 aa AA seqDB search
MTPNTLSELKQKYLDLLSHHYDSPEKLATEIINLESILELPKGTEHFVSDLHGEYDSFQH
VLRNGSGNVRAKINDIFKDKLTTKEINDLAALVYYPEEKLKLIKNEFNSRGQLNLWYITT
IERLIELITYCSSKYTRSKLRKALPTQYVYIVEELLYKSNEFNNKKSYYETLVNQIIELE
QSDDLIIGLSYTIQRLVVNHLHVVGDIYDRGPQPDKIMDTLIDYHSVDIQWGNHDVLWIG
AYAGSKVCLANLLRICARYDNLDIIEDAYGINLRPLLTLAEAYYDGNNPAFKPKKRPDKK
AALTKLEEDQITKIHQAIAIIQFKLEIPIIKRRPNFEMEERLVLEKTDYDNNKITVYGKT
YPLTNTCFTTVDPQNPGQLLPEEEDVINKLLLSFQQSEKLKRHMSFLMQKGTLYLPYNGN
LLIHGCIPVDENGEMEAFEIEGVKHQGRDLLDVFETHVREAFDHKDITDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIEDKVSHKEEKNPYYHLREDVDMIRKMLKDFGLNPDEGRI
INGHTPVKEIDGEDPIKADGKMLVIDGGFSKAYQKTTGIAGYTLLYNSFGMQLVAHQEFN
TKDKVLSDGADELSVRRVVDEELQRKKIRDTNDGYHIQEQIDILKTLMHDRYLN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgaatacactaagtgaacttaagcaaaagtatttagatttactttcccatcat
tacgatagcccagaaaaattagcaactgagattattaatttagagtctattttagaatta
ccaaaaggcacggaacactttgtcagtgatttacacggtgaatatgattcgttccaacat
gtattgcgcaatggttcaggcaacgtacgcgcgaaaataaatgatatctttaaagataaa
ttaaccactaaagaaattaatgatttagctgcccttgtttattatcccgaagaaaagtta
aagctaattaaaaatgaatttaattctagaggacaactcaatctgtggtatatcactacg
attgaacgcctaattgaacttattacatactgttcttctaaatatacacgttcaaaattg
cggaaagctttaccgacgcaatatgtctacattgttgaagaactattgtacaaaagcaat
gaatttaataacaaaaaatcttattatgaaacactcgtgaaccaaattattgaacttgaa
caatcagatgatttaattatcggtttatcttatacaattcaacgattagtcgtaaaccat
ctccatgttgttggtgacatttatgaccgtggacctcaaccagataaaattatggataca
cttatcgattatcattctgtcgatatccaatggggtaatcatgacgtattatggattggt
gcctatgccggttcaaaggtgtgtttagccaacttacttcgcatttgcgcgcgttatgat
aacttagatattatcgaagatgcatatggcattaatttacgaccgttactcactcttgcg
gaagcctattatgacgggaacaatcctgctttcaagcctaaaaaacggccggataaaaaa
gctgctttaacgaaactagaagaagatcaaataacaaaaatacatcaagcgattgccata
atccaattcaaattagaaatacctattattaaacgacgtccaaactttgaaatggaagag
cgtctcgtgcttgaaaaaacagattatgacaacaacaagattactgtgtatggtaagacc
tacccattaacaaatacgtgctttactactgtggatccacaaaatcctggtcaattgtta
cctgaagaagaagatgttattaataagctgttattgtcattccaacaatcagaaaaatta
aaacgtcatatgtcatttttaatgcaaaaaggtacattatatctcccttataacggtaat
ttactcatccatggctgtattcctgttgatgaaaatggagaaatggaagcttttgaaatt
gaaggtgtgaaacatcaaggacgtgatttactagatgtatttgaaacgcatgtacgtgaa
gcatttgaccataaggatattacagacgacttatctactgacctagtgtggtatttatgg
actggtaaatatagttcattatttggtaaacgtgccatgacaacatttgaacgttatttt
attgaagataaggtctcacataaagaagaaaagaacccttattatcacctacgtgaagat
gtggacatgattcgtaaaatgttaaaagactttggtctgaatcctgatgaaggacgtatt
atcaatgggcatacacctgttaaggaaattgatggagaagacccaattaaagctgatggt
aaaatgcttgtaattgatggtggtttctcaaaagcctatcaaaaaactacaggtattgct
ggctatacattattatacaattcattcggtatgcagcttgttgctcaccaagaatttaat
acgaaagataaagtactatctgatggggctgatgaactatctgtacgtcgagtcgtagat
gaagagctacaacgcaaaaaaatacgtgataccaatgatggttaccatattcaagaacaa
atcgatattctcaagacattaatgcatgatcgctatcttaattag

DBGET integrated database retrieval system