KEGG   Staphylococcus lugdunensis N920143: SLUG_05070Help
Entry
SLUG_05070        CDS       T01951                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sln00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sln00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sln00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sln00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559285..560151
Genome map
AA seq 288 aa AA seqDB search
MKQIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASRAGIEDIIIVTGKH
KRAIEDHFDNQKELEMVLEEKGKTELLKKVQYSTDLANIFYVRQKEQKGLGHAIYSARQF
IGDEPFAVLLGDDIVESDTPAIKQLMDAYDETGKSVIGVQEVAESDTHRYGIIDPLEKHG
RRYEVKQFVEKPAQGTAPSNLAIMGRYVLTANIFDYLKTQKRGAGNEIQLTDAIERLNKD
DQVYAYDFEGDRYDVGEKLGFVKTTIEYALKDQEMKEELTQFIKDLNL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaataaaaaaagccatcatacctgctgctggattagggacacgtttcttgcca
gcaactaaagcgatgcctaaagagatgttacccattttagataaaccaacgattcaatat
atcgttgaagaagcgtcacgtgcgggaattgaagatattattatcgtgactgggaaacat
aaacgtgccatcgaagaccattttgacaatcaaaaagaattggaaatggtattagaagaa
aaagggaaaacagaattactaaaaaaagtccaatattctacggatttagctaatattttt
tatgtgagacaaaaagaacaaaaaggtttaggacatgcgatttattcagcgcgacaattt
ataggtgatgagccatttgcggtattattaggtgatgacatagtagaatcagatacacca
gcaatcaaacaactaatggatgcgtatgatgagactggtaagtccgttattggtgtgcaa
gaagtagcagaatcagacacacaccgttatggcatcatagatcctttagagaaacatggt
cgtcgttatgaagtaaaacaattcgttgaaaaaccagcacaaggtactgcaccgtcaaat
ttagctattatgggacgatacgtcttaactgccaatatatttgattatctaaaaacacaa
aaaagaggcgctggaaatgaaatacaattgacagatgctatcgaacgcctaaacaaagat
gatcaagtatatgcatacgattttgaaggtgatcgctacgatgttggagaaaaacttggg
tttgttaaaacaacgatagaatatgccctcaaagatcaagaaatgaaagaagaattaaca
cagtttattaaagatttaaatttataa

DBGET integrated database retrieval system