KEGG   Staphylococcus lugdunensis N920143: SLUG_05440Help
Entry
SLUG_05440        CDS       T01951                                 

Gene name
opuCC
Definition
putative glycinebetaine/carnitine/choline-binding lipoprotein precursor
Orthology
K05845  
osmoprotectant transport system substrate-binding protein
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sln02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601797..602738
Genome map
AA seq 313 aa AA seqDB search
MNKVKTSLIIMVLSLLVLSGCSLPGLGDGNSKDDVKITTTETSETKIMGYIEKYMIEHET
KGKIKPTIIGNLGSSIIQHNALQRGDVNMSAVRYTGTELTSVLAAPPTKDTDKAMSESQR
LFKKKFNQKYYNSFGFENTYAFMVTKEVADKYHLKKVSDLKKYKDELRLGMDTQWMNRQG
DGYPAFQKDYGFKFDSARPMQIGLVYDALKNKKLDVAVGYSTDGRIAAYNLKVLKDDRKF
FPPYDGSPLATEKLIKDHPEIDKALKKLEGTVTTKEMQKLNYEADGQGKEPAVIAKEFLE
KHHFFDDKKEGSK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgaaaacaagcttaatcatcatggtcctatctctactcgtgttatctgga
tgtagtttaccaggccttggtgatggcaattcaaaagatgatgtcaaaattacaacaacc
gaaacaagtgaaacaaaaattatgggctacattgaaaaatatatgattgaacatgagacc
aaaggtaaaatcaaaccaacaattattggtaatcttggttcaagtattattcaacataac
gccttacaacgtggggatgtcaatatgtcagccgtgcgatatacagggacagaattaaca
agtgtccttgctgcaccaccaacgaaagatacagacaaagcaatgtctgaatcacaacgc
ttatttaaaaagaaatttaatcagaaatattataattcatttggctttgaaaatacctat
gcatttatggtgaccaaagaagttgccgacaaataccatttaaagaaagtatcggactta
aagaaatacaaagatgagctgcgtttagggatggatacccaatggatgaatcgccaaggt
gatggttatccagcattccaaaaagactacggcttcaaatttgatagtgcgcgaccaatg
cagattggtttagtatatgatgctttaaagaacaaaaaattagatgttgccgtaggttat
tcaacagatggacgtattgccgcatataacttaaaagttttaaaagatgatcgcaaattt
ttcccaccgtatgatggtagtccattagcaaccgaaaaattaattaaagatcatccagag
atagataaagcattgaaaaaattagaaggtaccgtcactactaaagagatgcagaaatta
aattacgaagcggatggtcaaggtaaagaaccagcagtcatagccaaagaatttctagaa
aaacatcatttctttgatgataagaaagaaggtagtaaataa

DBGET integrated database retrieval system