KEGG   Staphylococcus lugdunensis N920143: SLUG_06940Help
Entry
SLUG_06940        CDS       T01951                                 

Definition
putative aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_06940
   00052 Galactose metabolism
    SLUG_06940
Enzymes [BR:sln01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SLUG_06940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757703..758713
Genome map
AA seq 336 aa AA seqDB search
MIVEVEKQRHGIDLIKIDNNETSIVFSNYGARIVAWKFHDNNIVLGNRVEADEFYLNNPL
KFGATIGRYSGRIEAGAFKLNQDRYQLEQNDGLNHIHGGSNGCDQVLFDYDIVEGISDVK
VIFRAKLNASDDGYPGDLALKVIHHYDIEHRWTITYEAETTATTIFNPTNHVYFNLNRDN
NVIDNHQIHAKDLKMYLLNRQHFLLNDTPINLASQFGSDHITFQKIFQAHQDDIKQQMER
YQGLDHPFELSEQTLSVENGEFKLQIDTDMPYVVIYTMNHPETWESQLNIYKPHSGFTLE
TQFLPNDINYFGQQAPSILRAGQQFSSTTSYQISEQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgaagtagaaaagcaaagacatggtatcgaccttattaaaattgacaataat
gaaacaagcatcgtcttttcaaattatggtgcaagaattgtcgcttggaaatttcatgac
aataatatcgtcttaggtaatcgtgtagaagctgatgaattttatctaaataatccattg
aaatttggtgcaacaataggtcgttatagcggtcgaattgaggcaggcgcttttaagctt
aatcaagatcgctatcaacttgaacaaaatgatgggcttaaccatatccatggtggttca
aatggatgtgatcaagtcctatttgactatgacatcgttgaaggaataagcgatgtaaaa
gttattttcagggcaaaattaaatgctagtgatgacggttatccaggagatttagcgctt
aaagtgatacatcattatgatatagaacatcgttggacgattacttatgaagctgaaacg
acggctacaactatatttaatccaacgaatcacgtctactttaatttgaatagagataac
aatgttattgataatcatcaaatacatgcgaaagacttaaagatgtatttattaaaccgt
caacatttcttattgaatgacacacctataaacttagcatctcaatttggttcagaccat
attacatttcaaaaaatttttcaggcgcatcaagatgatattaagcaacaaatggaacgt
tatcaagggttagaccatccatttgaactaagcgaacaaacattgtctgtagaaaatgga
gagttcaaattacaaatagatacagatatgccttatgttgtgatatacacgatgaatcat
ccagaaacttgggagagccagttaaatatatataaaccgcattcaggttttacattagaa
acacaatttttacccaatgatataaattattttggtcaacaagcaccgtctattttaaga
gctggccaacaattttcttcaacaacaagttatcaaattagtgagcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system