KEGG   Staphylococcus lugdunensis N920143: SLUG_09660Help
Entry
SLUG_09660        CDS       T01951                                 

Gene name
murA1
Definition
putative UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SLUG_09660 (murA1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SLUG_09660 (murA1)
Enzymes [BR:sln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SLUG_09660 (murA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013322..1014587
Genome map
AA seq 421 aa AA seqDB search
MDRIVIKGGHRLSGEVQVEGAKNAVLPVLTASLLATEGTSKLINVPKLSDVETINNVLST
LNADVSYDIAGNAVTVDATATLNEEAPYEYVSKMRASILVMGPLLARLGHAIVALPGGCA
IGSRPIEQHIKGFEALGADIHLENGNIYANAKNGLQGANIHLDFPSVGATQNIIMAASLA
NGKSVIENAAKEPEIVDLANYINEMGGRITGAGTDTITIHGVNKLTGVVHSIIPDRIEAG
TMIIAGAITRGDVYVRGAIKEHMTSLVYKLEEMGVQLAFDEEGVRVTAPDTLQPVDVKTL
PHPGFPTDMQSQMMALLLTAEGHKVITETVFENRFMHVAEFRRMNANITVEGRNAKIEGK
SELQGAQVKATDLRAAAALILAGLVADGTTQVTELKHLDRGYVNFHGKLKELGADIQRIN
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggatagaatagttataaaaggtgggcatcgcctatcaggagaagttcaagtagaaggt
gctaagaatgcagtattaccagtgctaacagcatcattattggcaacagaaggtactagc
aaactgattaatgttcccaaattgagtgatgttgaaacaataaataatgtgttatcaaca
ctgaatgctgatgtttcatatgatattgcaggaaatgctgtgactgttgatgcaactgcg
acattaaatgaagaggcgccttatgaatatgtaagtaaaatgcgtgcaagtatcttagtt
atgggacctctgctagcgcgtttaggtcatgcaattgtagctttaccaggtggttgtgct
attggaagtagaccgattgagcaacatattaaagggtttgaagccttaggtgccgatatt
catttggaaaatggaaatatttatgccaatgcaaaaaatggcttgcaaggagctaatatt
catttagattttccaagcgtaggagctacacaaaatattataatggctgcatctttagct
aatggcaaatctgtgattgaaaatgcagctaaagaaccagaaattgttgatttagcgaat
tatataaatgaaatgggcggtagaattactggcgcaggtactgatacgattacaattcac
ggtgtgaataaattaaccggagttgttcattctattattccagaccgcattgaagctgga
acaatgattattgcaggtgcaataacgcgaggagacgtttatgtaagaggtgctattaaa
gaacatatgacaagcttagtgtacaaacttgaagaaatgggtgtacaactagcctttgac
gaagaaggtgtacgtgtaacagcgccagatacattacagcctgttgatgtgaaaacgtta
cctcatccaggttttcctacagatatgcaatcacaaatgatggctttattgttgacagct
gagggccataaagttattacagaaacggtatttgaaaatcgttttatgcatgttgcagaa
tttagaagaatgaatgccaatattactgtagaaggtcgtaacgctaaaattgaaggcaaa
agtgaattacaaggtgcacaggttaaagcaactgatttaagagctgcagcagcacttatt
ttagctggtttagtagcagatggtacaacacaagttactgaacttaaacatttagaccgt
ggttatgtgaacttccatggtaaattaaaagaattaggagcagatatacaacgtataaat
gcttaa

DBGET integrated database retrieval system