KEGG   Staphylococcus lugdunensis N920143: SLUG_11370Help
Entry
SLUG_11370        CDS       T01951                                 

Gene name
hemY
Definition
putative protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLUG_11370 (hemY)
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SLUG_11370 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1197296..1198693
Genome map
AA seq 465 aa AA seqDB search
MSKKIAIVGAGITGLSSAYYLNKQDADLDITVFEAANRPGGKIQTYRQDGYTIELGPESY
LGRKTIMTDIAHEIGLGQDLITNRTGKSYIFAKNKLYPIPGGAIMGIPTDIKPFIKTKLI
SPLGKLRAGLDLFKKPIIMPNNDISVGQFFRQRLGDEVLEHLIEPLIGGIYGTDIDRLSL
MSTFPEFKEREEQYGSLIKGMKYEKEQRIKKRELYPGSPKGQFKQFRHGLSSFIEALADF
IKQKGVKIEYHTPIKDILVSQKSYQLITEENKVDFDAIIVTTPHQTFMNWFSHDPAFDYF
KHMDATSVATIVMAFDESNIENTYDGTGFVIARTSDTHITACTWTSKKWPFTTPEGKVLI
RAYIGKPGDTVVGDHTDDELVSMARKDLTKMMTFKGEPDFTIVNRLEKSMPQYHVGHIKN
IHEIQSHIKRTYPRLRITGAPFEAVGLPDCISQAKKAADEIYHEL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaaaaaattgcgatagttggagcgggaattactggattatcaagtgcatattat
ttaaataagcaagacgccgatttagatatcactgtttttgaagcagcaaatcgtcctggg
gggaaaattcaaacctatcgtcaagatggttatacgattgagctgggtcctgaatcatat
ttaggacgcaaaacaataatgacagatatcgcacatgaaatcgggcttggacaagactta
attactaacagaacagggaagtcttatatttttgccaagaataagttatacccaattcct
ggtggggcaattatggggattccaacagatataaaaccatttattaagacaaaattaatc
tctccgttgggcaaactacgtgcaggtttagatttatttaaaaaaccaatcatcatgcca
aataacgatatttcagtcggccagttttttagacagcgtttaggagatgaagtacttgaa
catcttattgaaccattaattggcggaatttatggtacagatatagatcgattaagtcta
atgagtacatttcctgaatttaaagagcgggaagaacaatatggcagtttaattaaaggt
atgaaatatgaaaaagagcaacgtatcaagaaaagagaattatatcctggatcgcccaaa
ggacaatttaaacaatttagacatggtttgagttcgtttattgaagcattggctgatttt
attaaacaaaaaggcgtaaaaattgaataccatacacctattaaagatattttagtgtca
caaaaaagttatcaacttattacagaagaaaataaagttgattttgatgcaattattgtg
actacacctcatcagaccttcatgaactggtttagtcatgatccggcatttgattacttt
aagcatatggatgctacatcagtagctacaattgtcatggcctttgatgagtccaatatt
gaaaatacctatgatggaactggatttgtaatagctagaaccagtgacacgcacattacg
gcttgtacatggacctcaaaaaaatggcctttcactacgccagaaggcaaagtgttaata
cgtgcttacattggaaaacctggtgatacagtagtaggtgaccataccgatgatgagtta
gtgtcaatggcacggaaagatttgacaaaaatgatgacatttaaaggagaaccagatttt
acaattgttaatcgtttagaaaaaagtatgccacagtaccatgttggacatataaaaaat
attcatgaaattcaatcgcatattaaacgaacatacccgagattgcgtattaccggtgca
ccatttgaagcagtaggacttccagactgcatatcacaagcgaaaaaagctgctgatgaa
atatatcatgaattataa

DBGET integrated database retrieval system