KEGG   Staphylococcus lugdunensis N920143: SLUG_11970Help
Entry
SLUG_11970        CDS       T01951                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00620  Pyruvate metabolism
sln00640  Propanoate metabolism
sln00680  Methane metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_11970 (acsA)
   00620 Pyruvate metabolism
    SLUG_11970 (acsA)
   00640 Propanoate metabolism
    SLUG_11970 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SLUG_11970 (acsA)
Enzymes [BR:sln01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SLUG_11970 (acsA)
Lipid biosynthesis proteins [BR:sln01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SLUG_11970 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCB53676
Position
1256366..1258075
Genome map
AA seq 569 aa AA seqDB search
MKVEVYKSEPGEYNLSNYEDVYQNFDWNEVEKAFSWYKTGKINMAYECIDRHVDDGKGDK
IALNYKDNERQEQYTFSDIQHLSNQAANVLVEHANVQKGDRVFIFMPRTPELYFAFLGIL
KVGAIVGPLFEAFMEKAVTDRLANSEAKVVITTNKLLHRIPQEKLPHLKKIIIVDDDVSD
DYIDFNKLMQSASTSFNITWLQRDDGLILHYTSGSTGQPKGVLHVQQAMLLHYITGKYVL
DLQENDVYWCTADPGWVTGTSYGIFAPWLNGVTNCIAGGRFTPEQWYKMIEAFKVTIWYT
APTALRMLMSAGDDIVQKYNLSTLRSILSVGEPLNPEVIKWAKSAYGKRVLDTWWMTETG
GHMIVNYPAMDVKLGSMGKPIPGVEAAIIDDEGNELPANRMGNLAIKKGWPSMMYEIWDN
PEKYRSYFIGDWYISGDSAYKDEDGYFWFQGRVDDVIMTAGERVGPFEVESKLVEHEAVA
EAGVIGKPDPVRGEIIKAFVALRQGYEPTDDLKEDIKKYVKEGLSAHAAPREIEFRDKLP
KTRSGKIMRRVLKAWELNLDAGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagaagtatataagagtgaaccgggagaatataatttaagcaattatgaggat
gtatatcaaaactttgattggaatgaagtagaaaaagctttttcatggtataaaacaggg
aaaatcaatatggcatatgaatgtatagatcgtcacgtagacgatggtaaaggagacaaa
atcgctttaaactataaagataatgagcgtcaggaacaatatacattttcagatatacag
cacttatccaatcaagcggcgaatgtattagtagagcatgcaaatgtgcaaaaaggggat
cgcgtttttatctttatgccgagaacacctgaattgtattttgcctttttaggtatatta
aaagtaggtgcaattgttggtccattatttgaggcttttatggaaaaggcagtaacagat
cgtttagcgaatagtgaagccaaagttgttataacaacaaataaattacttcatcgtata
ccacaagaaaaattaccacatctcaaaaaaatcattatcgtggatgatgatgtgtctgat
gactatatagattttaataagttaatgcaatcagctagcacatcatttaatatcacatgg
ttacaacgcgacgatggtttaatattacattatacttcaggttcaacaggacagcctaag
ggcgtacttcatgtacaacaagcaatgctacttcattatataacggggaaatatgtatta
gatttacaagaaaacgatgtatattggtgtacagctgatccgggttgggttactggaact
tcttacggtatatttgcaccttggctaaatggcgtcacaaattgtatagcaggtggacgt
tttacgcctgaacagtggtataagatgattgaagcattcaaagttacaatttggtatacg
gcaccaaccgcgttacgcatgttgatgagtgctggtgatgatattgttcaaaaatataat
ctgtcaacgttacgatctattctatctgtaggagaaccattaaacccagaagttatcaaa
tgggcaaaatcagcatatggtaaacgtgttcttgatacgtggtggatgactgaaacagga
ggacatatgattgttaattatcctgcaatggatgtcaaattgggttctatgggaaaacca
attcctggtgtggaagctgctattatcgatgatgagggaaatgaattgccagctaatcgt
atgggcaatttagcaataaaaaaggggtggccgtctatgatgtatgaaatatgggataat
ccagaaaaatatcgttcttattttataggagactggtatatatctggggattcagcatat
aaagatgaagatgggtacttctggtttcaaggtcgtgtagatgatgtcatcatgacagca
ggcgaacgtgtgggaccatttgaagtcgaatctaaattagttgagcatgaagctgttgct
gaagctggtgtcatcggaaagcctgatccagtacgtggcgaaattataaaagcatttgtt
gctttacgccaaggatatgaaccgactgatgatttaaaagaagatattaaaaaatatgta
aaagaaggtctatcagctcatgctgctcctagagaaattgagtttagagataaattgcct
aagacgcgttcaggtaaaattatgcgacgtgtacttaaagcatgggaacttaatttagat
gcaggtgatttaagtactatggaggactaa

DBGET integrated database retrieval system