KEGG   Staphylococcus lugdunensis N920143: SLUG_12290Help
Entry
SLUG_12290        CDS       T01951                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:sln01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sln01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sln00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sln00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sln00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sln00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sln00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1296526..1297494
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNNIEVYGIYQGYQGLLDDNIHKLELGSVGDT
IQRGGTFLYSARCPQFKEAEHRKVGIDNLRKRGIEGLVVVGGDGSYRGAQRISEECPEIQ
TIGVPGTIDNDINGTDFTIGFDTALNTIIECVDKIRDTASSHARTFIVEVMGRDCGDLAL
WAGLSVGAETIMVPEVKTEIKDVAEKIESGIKRGKKHSIVMVAEGCMSGQECADELMKYI
NVDTRVSVLGHIQRGGSPSGTDRVLASRLGGHAVDLLIQGKSGLGVGITHNQLTATPFDE
IFKISDHKFNNDIYELAKKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgcagtattaactagcggtggtgactcaccaggtatgaacgctgcagta
agagcagttgttcgtacagcgatttacaacaacatcgaggtttatggcatttatcaaggt
taccaaggtttactagatgataatatccataaattagaacttggctctgtaggggatacc
atacaacgtggaggtacatttttatactcagcgagatgtcctcaatttaaagaagcagag
catcgtaaagttgggatagataatcttcgaaagagagggattgaaggtctggttgtcgtt
ggtggcgatggtagttatcgaggcgcacaacgtattagcgaagaatgtcctgaaattcaa
actataggtgttccaggtacgattgataacgatattaatggtactgattttacaatcggt
tttgacacagcattaaatacaatcattgaatgtgtcgataaaataagggatacagcttct
agccatgctcgaacatttattgtagaagtaatgggacgtgattgtggagatctagctttg
tgggctggtctatcagtaggtgccgaaacgattatggtgccagaagttaaaacagaaatt
aaagacgttgccgaaaaaatagagagtggtattaaacgtggtaagaaacattcaattgta
atggttgctgaaggttgtatgagtggccaagaatgtgcggatgaattaatgaaatatata
aacgttgacacacgtgtttcagtattaggtcacattcaacgtggtggaagcccttcaggc
actgaccgtgtactcgcatcaaggttaggcggtcatgcagttgatttgttaattcaaggt
aaatctggtcttggcgtaggtattacgcataaccaacttacagctacgccattcgatgag
attttcaaaatttcagatcataaatttaacaatgatatttatgaactagctaaaaagcta
tctatttaa

DBGET integrated database retrieval system