KEGG   Staphylococcus lugdunensis N920143: SLUG_12580Help
Entry
SLUG_12580        CDS       T01951                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLUG_12580 (hemB)
Enzymes [BR:sln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SLUG_12580 (hemB)
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLUG_12580 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1331838..1332812
Genome map
AA seq 324 aa AA seqDB search
MKFDRHRRLRISETMRNLVRENHVRKEDLIYPIFVVEKDNVKSEITSLPGVYQISLNLLD
DEINEAYDLGIRAIMFFGVPNAKDEVGSGAYDLNGVVQQATRKAKSLHEDLLIVADTCLC
EYTDHGHCGVIDEHTHDVDNDKSLPLLVKTAVSQVEAGADIIAPSNMMDGFVAEIRQGLD
DAGYYNVPIMSYGIKYASSFFGPFRDAADSAPSFGDRKTYQMDPANRLEALRELESDLKE
GADMMIVKPALSYLDIVRDVKNNTNIPVVAYNVSGEYAMTKAAAINGWIDEERVVMEQMV
SMKRAGVDMIITYFAKDICRYLDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatagacacagaagattgcgtatttcagaaacgatgcgcaatttagtaaga
gaaaatcacgtaagaaaagaagacttaatttatcctatattcgtagttgaaaaggacaat
gtaaaaagtgagattacttctctacctggagtatatcaaataagcttaaatttattagat
gatgaaattaatgaagcatatgatttaggaattagagcaattatgttctttggtgttccg
aatgctaaagatgaagttggttcaggtgcttatgatcttaatggtgttgttcaacaggca
actcgtaaagcgaaatcattgcacgaagatttattaattgttgcagatacttgtttgtgt
gaatacactgaccatggtcattgtggtgtcattgatgaacatacacatgatgttgataat
gacaaatcattgccattacttgttaaaacagctgtttctcaagttgaagctggtgcagat
attattgcacctagcaatatgatggatgggtttgtggctgaaatacgccaaggtttggat
gacgcaggctactataatgtaccaattatgagttatggtattaaatatgcttctagtttc
tttggaccatttagagacgctgctgattctgcaccatcatttggtgatagaaagacttac
caaatggacccagcaaatcgtttagaagcattaagagaattagaaagtgatttaaaagaa
ggcgcagatatgatgattgttaaacccgctttaagttatttggatattgtgcgggacgtt
aaaaataatacgaatatccctgtagtggcatacaacgtcagtggtgagtatgcaatgaca
aaagctgcagcaataaatggttggattgatgaagaacgtgttgtaatggaacaaatggta
tcaatgaaacgtgccggtgtagatatgattattacttattttgcaaaagatatatgtcgt
tatttagataaatag

DBGET integrated database retrieval system