KEGG   Staphylococcus lugdunensis N920143: SLUG_12760Help
Entry
SLUG_12760        CDS       T01951                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sln03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347676..1348287
Genome map
AA seq 203 aa AA seqDB search
MMYAYIKGQLTQLFPTHVVVETQGIGYEIQTPNSYRFQQFYNQAVTIYTSLIVREDAQLL
YGFINEEEKEMFLNLIKVTGIGPKSALAILATSTPNEVKRAIEDENDAYLTKFPGIGKKT
ARQIILDLKGKVNYTEASSNDSIHIDDISSTSQKDNYIAEALLALEALGYSKREISKVEK
TLQQQVVTSVDEAVKIGLQSLIS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacgcatatattaaagggcaattaactcagctattcccaacccatgtagtggtt
gaaacacaaggtatcggttatgaaatacaaacaccaaattcatatcggttccaacaattt
tataatcaagcagtaacgatttacacatcactgattgttagagaggatgctcagttactt
tatggttttattaatgaagaagaaaaggaaatgtttctaaatctgattaaagttacagga
attggacctaaatcagcattagctatcttggctacgagcacacctaatgaggttaaacgt
gcaattgaggatgaaaatgacgcatatctaactaaatttcctggtattggaaagaaaact
gcgcgtcaaatcatacttgatttaaaaggaaaagttaattatacagaagcatcatctaat
gattcaatccatatagatgatatatctagtacctctcagaaagataattatattgcggaa
gccttattagcgttagaagctttaggttattcaaagcgtgaaatttcaaaagtcgaaaaa
acgctacaacagcaagtagtaacgtcagttgatgaagcggttaagataggtttacaatcc
ttaatttcctaa

DBGET integrated database retrieval system