KEGG   Staphylococcus lugdunensis N920143: SLUG_12970Help
Entry
SLUG_12970        CDS       T01951                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sln00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SLUG_12970
Enzymes [BR:sln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SLUG_12970
DNA repair and recombination proteins [BR:sln03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SLUG_12970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA_12 AAA AAA_14 HHH_3 AAA_18 AAA_22 UvrD_C Helicase_RecD TsaE Mg_chelatase ABC_tran 5_3_exonuc AAA_29 AAA_16 AAA_28 NACHT AAA_17 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CCB53777
Position
1372253..1374640
Genome map
AA seq 795 aa AA seqDB search
MDNPTLFEPTMLKGTVEVILFQNQDNFYTVLKVDTIESNESFDTMPTVVGFFPNIVEGDV
YTFKGQVVAHPKYGKQLKADTFEKELPQTKDAIITYLSSDLFKGIGKKTAQNIVNTLGEN
AINDILAHPDILTKVSNLSKKKQEQIAQQIAANQESEKIMIHLHDLGFGPKLSMAIYQFY
QSETINVVDNNPYKLVYDIKGIGFNKADTLARNIGIDFNDPERLKAGILFTLEEECIKQG
HTYLPAETILKSAQTMLSTQGDEIIEIHQLEEMLQILMEEDKLILDQQKIAIPSLYYSEL
KSVQNLYRILTHTHKLNELEQSDLQLHIGEIEDSNEVHYAASQKEALQTAINSKIMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYADYTDDDFPVVLAAPTGRASKRLQEATGLEAMT
IHRLIGWNQDTQPEDILDNEIKAKLIIIDEMSMVDTWLFHQFLNAVPLDAQIVFVGDEDQ
LPSVGPGQVFKDLIQSKKIPRVNLTEVYRQQDGSSIIELAHHMKQNESIDITKRYHDRSF
INCSAEQIPDVVKKVVSSAVSKGYDMSDIQVLAPMYKGSAGIKRLNQILQTILNPKEPDA
REIEFGDAAFRKGDKVLQLVNRPNDNIFNGDIGIIVGIFWAKENALNKDVIIVDFDGNEI
TFTRQDLIELTHAYCTSIHKSQGSEFPIVIMPVVKQYFRMLQKPILYTGLTRAKQSLVLL
GDPQAFDIGLKTNGQVRMTQLYDLLEAYFGHETQNSTDDNIIAKHKKDTLSAATIYQIDP
MINMNQMTPYDFIER
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggataaccctacactatttgaaccaacgatgttaaagggcaccgtcgaagttattttg
ttccaaaatcaagataatttctatactgtacttaaagttgataccattgaatctaatgaa
tcgttcgatacgatgccaacggttgtagggtttttcccaaatattgttgaaggcgacgta
tacacctttaaaggacaggttgttgcgcatccaaaatatggcaaacaactaaaagctgat
acatttgaaaaagaattaccacaaacgaaagatgctattattacctacttatcaagtgat
ttatttaaaggtattggtaaaaagacagcacaaaatattgttaatactttgggagaaaat
gcaataaatgatattttagctcatccagacatattaacaaaagtttcaaatctttctaaa
aagaaacaagagcaaattgcacaacaaatagcagccaatcaagaatcagaaaaaatcatg
atacacttacatgatttaggatttggccctaaactatcaatggcaatctatcagttttat
caaagtgaaacaataaacgtcgttgataataacccgtataaacttgtatatgatattaaa
ggaattggatttaataaagctgatacattagcacgtaatatcggcatcgactttaatgac
ccagaacgattaaaagctggcatattattcacactagaggaagaatgtattaaacaaggg
catacttatttacctgctgaaacaattcttaaatcagcacaaacaatgttaagtacgcaa
ggggatgaaataattgaaatacatcaacttgaagaaatgttgcaaattttaatggaagaa
gataagttgattcttgatcaacaaaaaattgccatccccagtctttactactcagaatta
aaaagcgtacaaaacttatatcgtatattaactcatacccataaattaaatgaacttgag
caatctgatttacagttgcatattggagagatagaagatagcaatgaagtacattatgct
gcatcacaaaaagaggctttacaaacagctataaactcaaaaatcatgttattaactggc
ggacctggaactggtaagacaactgtcattaaaggtattgtagagttatacgctgaaatt
catggactttctttagattatgcggattacactgatgatgatttcccagtagtattagca
gctcctacaggcagagcatcgaaacgtttacaagaagctactggcttagaggcaatgacc
atccaccgacttataggatggaatcaagatacacaaccagaagacattttagataatgaa
attaaagcaaaattaattatcatagatgaaatgtctatggttgacacttggttatttcat
cagtttttaaatgcggtacctttagatgcccaaattgtatttgttggagatgaagaccaa
ctgccttctgttgggcctggacaagtatttaaggacttaatccagtctaaaaaaatacca
cgtgtcaatttaactgaagtctaccgacaacaagatggttcaagtattattgaattagct
caccacatgaaacaaaacgaatccatagatattacaaaacgttatcatgatagaagcttc
attaattgtagtgcagaacaaattcctgacgttgttaagaaagtagtatccagtgcagtt
agtaaaggatatgacatgagtgatattcaagtacttgctcccatgtataaaggaagtgca
ggtattaaacgtttaaatcaaattctgcaaacaattttaaatcctaaagaaccagacgcc
cgtgaaattgaatttggtgatgctgcattccgcaaaggcgataaagtattacagttagta
aatcgtcctaatgacaatatttttaatggagatattggtattattgttggcattttttgg
gcaaaagaaaatgctttaaataaagatgttattatcgtcgattttgacggtaatgaaatt
acatttacacgacaagacttaattgaattaacgcatgcatattgcacttcgattcacaag
tcccaaggttcagaattcccaatcgttattatgcccgtagtgaaacaatattttagaatg
ttacaaaagcctattctttatactggtttgactagagctaaacaatctttagtattacta
ggggatccacaagcctttgacattggtcttaaaacaaatggtcaagttagaatgacgcaa
ttatatgatttattagaagcatattttggacacgaaacgcagaattctactgatgataat
atcatagctaaacataaaaaagatacattatcagcagcgacaatttatcaaatagatccg
atgattaacatgaatcaaatgacgccatatgactttattgaacgttga

DBGET integrated database retrieval system