KEGG   Staphylococcus lugdunensis N920143: SLUG_12970Help
Entry
SLUG_12970        CDS       T01951                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sln03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1372253..1374640
Genome map
AA seq 795 aa AA seqDB search
MDNPTLFEPTMLKGTVEVILFQNQDNFYTVLKVDTIESNESFDTMPTVVGFFPNIVEGDV
YTFKGQVVAHPKYGKQLKADTFEKELPQTKDAIITYLSSDLFKGIGKKTAQNIVNTLGEN
AINDILAHPDILTKVSNLSKKKQEQIAQQIAANQESEKIMIHLHDLGFGPKLSMAIYQFY
QSETINVVDNNPYKLVYDIKGIGFNKADTLARNIGIDFNDPERLKAGILFTLEEECIKQG
HTYLPAETILKSAQTMLSTQGDEIIEIHQLEEMLQILMEEDKLILDQQKIAIPSLYYSEL
KSVQNLYRILTHTHKLNELEQSDLQLHIGEIEDSNEVHYAASQKEALQTAINSKIMLLTG
GPGTGKTTVIKGIVELYAEIHGLSLDYADYTDDDFPVVLAAPTGRASKRLQEATGLEAMT
IHRLIGWNQDTQPEDILDNEIKAKLIIIDEMSMVDTWLFHQFLNAVPLDAQIVFVGDEDQ
LPSVGPGQVFKDLIQSKKIPRVNLTEVYRQQDGSSIIELAHHMKQNESIDITKRYHDRSF
INCSAEQIPDVVKKVVSSAVSKGYDMSDIQVLAPMYKGSAGIKRLNQILQTILNPKEPDA
REIEFGDAAFRKGDKVLQLVNRPNDNIFNGDIGIIVGIFWAKENALNKDVIIVDFDGNEI
TFTRQDLIELTHAYCTSIHKSQGSEFPIVIMPVVKQYFRMLQKPILYTGLTRAKQSLVLL
GDPQAFDIGLKTNGQVRMTQLYDLLEAYFGHETQNSTDDNIIAKHKKDTLSAATIYQIDP
MINMNQMTPYDFIER
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggataaccctacactatttgaaccaacgatgttaaagggcaccgtcgaagttattttg
ttccaaaatcaagataatttctatactgtacttaaagttgataccattgaatctaatgaa
tcgttcgatacgatgccaacggttgtagggtttttcccaaatattgttgaaggcgacgta
tacacctttaaaggacaggttgttgcgcatccaaaatatggcaaacaactaaaagctgat
acatttgaaaaagaattaccacaaacgaaagatgctattattacctacttatcaagtgat
ttatttaaaggtattggtaaaaagacagcacaaaatattgttaatactttgggagaaaat
gcaataaatgatattttagctcatccagacatattaacaaaagtttcaaatctttctaaa
aagaaacaagagcaaattgcacaacaaatagcagccaatcaagaatcagaaaaaatcatg
atacacttacatgatttaggatttggccctaaactatcaatggcaatctatcagttttat
caaagtgaaacaataaacgtcgttgataataacccgtataaacttgtatatgatattaaa
ggaattggatttaataaagctgatacattagcacgtaatatcggcatcgactttaatgac
ccagaacgattaaaagctggcatattattcacactagaggaagaatgtattaaacaaggg
catacttatttacctgctgaaacaattcttaaatcagcacaaacaatgttaagtacgcaa
ggggatgaaataattgaaatacatcaacttgaagaaatgttgcaaattttaatggaagaa
gataagttgattcttgatcaacaaaaaattgccatccccagtctttactactcagaatta
aaaagcgtacaaaacttatatcgtatattaactcatacccataaattaaatgaacttgag
caatctgatttacagttgcatattggagagatagaagatagcaatgaagtacattatgct
gcatcacaaaaagaggctttacaaacagctataaactcaaaaatcatgttattaactggc
ggacctggaactggtaagacaactgtcattaaaggtattgtagagttatacgctgaaatt
catggactttctttagattatgcggattacactgatgatgatttcccagtagtattagca
gctcctacaggcagagcatcgaaacgtttacaagaagctactggcttagaggcaatgacc
atccaccgacttataggatggaatcaagatacacaaccagaagacattttagataatgaa
attaaagcaaaattaattatcatagatgaaatgtctatggttgacacttggttatttcat
cagtttttaaatgcggtacctttagatgcccaaattgtatttgttggagatgaagaccaa
ctgccttctgttgggcctggacaagtatttaaggacttaatccagtctaaaaaaatacca
cgtgtcaatttaactgaagtctaccgacaacaagatggttcaagtattattgaattagct
caccacatgaaacaaaacgaatccatagatattacaaaacgttatcatgatagaagcttc
attaattgtagtgcagaacaaattcctgacgttgttaagaaagtagtatccagtgcagtt
agtaaaggatatgacatgagtgatattcaagtacttgctcccatgtataaaggaagtgca
ggtattaaacgtttaaatcaaattctgcaaacaattttaaatcctaaagaaccagacgcc
cgtgaaattgaatttggtgatgctgcattccgcaaaggcgataaagtattacagttagta
aatcgtcctaatgacaatatttttaatggagatattggtattattgttggcattttttgg
gcaaaagaaaatgctttaaataaagatgttattatcgtcgattttgacggtaatgaaatt
acatttacacgacaagacttaattgaattaacgcatgcatattgcacttcgattcacaag
tcccaaggttcagaattcccaatcgttattatgcccgtagtgaaacaatattttagaatg
ttacaaaagcctattctttatactggtttgactagagctaaacaatctttagtattacta
ggggatccacaagcctttgacattggtcttaaaacaaatggtcaagttagaatgacgcaa
ttatatgatttattagaagcatattttggacacgaaacgcagaattctactgatgataat
atcatagctaaacataaaaaagatacattatcagcagcgacaatttatcaaatagatccg
atgattaacatgaatcaaatgacgccatatgactttattgaacgttga

DBGET integrated database retrieval system