KEGG   Staphylococcus lugdunensis N920143: SLUG_14650Help
Entry
SLUG_14650        CDS       T01951                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SLUG_14650 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SLUG_14650 (trpC)
Enzymes [BR:sln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SLUG_14650 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1537565..1538350
Genome map
AA seq 261 aa AA seqDB search
MMTILTEIVDYKKRLLANGYYDNKLKSLKDLTPINKPTFKSTLSKSKHLSIIAEIKTKSP
SVPKFNVKDLVKQVQEYEANGAAAISILTDEHYFDGSFERLQNLYSHTTLPILCKDFIID
TIQIDVAKKAGASMILLIVHCLTDSKLKQLYKYAHKLGLEVLVEVHSIKELQRAHQLNAS
LIGINNRDLTTFNTHVEHTNQILRQKHSGRFYISESGIHSREDVLSIVQTGISGILIGGA
LMNCTNISEFLPSLMLEKVNL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgatgactattttaactgaaattgttgattataaaaaaagactattagctaatggttac
tatgacaacaaactaaaatcattaaaagatttaacgccaataaataagcctacatttaaa
tctacacttagcaaaagtaaacatttatctatcattgctgaaattaaaacgaaaagtcct
tcagttccaaaattcaatgtaaaagatttagttaaacaagttcaagaatatgaggctaat
ggcgcagctgcaatttctatattaacggatgaacattatttcgatggaagctttgaacgt
ctacaaaacttatacagccatacaacacttcctatactttgtaaagattttattattgat
acgatacaaatcgatgttgcaaagaaagctggggcctcaatgatattactaatcgttcat
tgtttaacagatagtaaactaaaacaactttacaaatatgcacataaactaggtttggaa
gtactggttgaggtccacagcattaaagaattacaacgtgcgcatcaacttaatgcatca
ttaatcggaattaataatagggatttaacaacttttaacactcatgtagaacataccaat
caaatattacgtcaaaaacattctggcagattctacatttctgaaagtggtatccattcg
agagaagacgtgctatcaatagtacagacaggaatatctggtatactcattggcggtgct
ttaatgaattgcacaaatatctctgaattcttgccaagtcttatgttagaaaaggtaaat
ttatga

DBGET integrated database retrieval system