KEGG   Staphylococcus lugdunensis N920143: SLUG_14670Help
Entry
SLUG_14670        CDS       T01951                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00260  Glycine, serine and threonine metabolism
sln00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01130  Biosynthesis of antibiotics
sln01230  Biosynthesis of amino acids
Module
sln_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLUG_14670 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SLUG_14670 (trpB)
Enzymes [BR:sln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SLUG_14670 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Nif11
Motif
Other DBs
NCBI-ProteinID: CCB53952
Position
1538975..1540192
Genome map
AA seq 405 aa AA seqDB search
MYNNIQTEADQLGFFGEYGGQFVPETLMPAVLELKQAYNKAKKDPQFQQELNDYLTEYVG
RATPLTFAQSYTQRLGGAKIYLKREDLNHTGAHKINNALGQALLAKRMGKRKLVAETGAG
QHGVASATVAALFDMELIVFMGKEDIQRQQLNVFRMELLGAKVVSVEDGQGTLSDAVNKA
LQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGNEIKTQILEKEGRLPNAVVACVGG
GSNAIGTFYPFIKDEVQLYGVEAAGEGANTNKHALAIGKGKPGVLHGAKMYLIQDRHGQI
ELAHSISAGLDYPGIGPEHSYYNDIGRVHYTNATDTEAMEALIRFTKDEGIIPAIESAHA
LSYVEKLAPQMDKDQLLVVTISGRGDKDMETIRQYIQQRGDSHAQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtataacaatattcaaacagaagcagatcaattaggtttttttggcgaatacggtgga
caatttgtaccagaaacattaatgccagcagtattagaattaaaacaagcttataataaa
gcaaaaaaagatcctcaatttcaacaagagctaaatgattatttaactgaatacgtaggt
cgagccacaccattaacctttgcacaatcttacacacaacgtttaggcggcgcaaagata
tatttaaaacgtgaagatttaaatcacactggtgctcataaaataaataatgcgcttgga
caagctttactggcaaaacgtatgggcaaacgtaaattggtagcggaaactggtgcagga
caacatggtgtagcaagtgcaaccgttgcagcattattcgatatggaactaattgtattt
atggggaaagaagatatccaacgtcaacaactaaacgtgtttcgtatggaactcttaggc
gcaaaggtagtctcagttgaagatggtcaagggacattatcagacgccgttaataaagca
ttacaatactgggttagtcatgttgatgatacacattatttactcggttcagcactagga
cctgatccatttcctacgatagtaagagattttcaaagtgttatcggaaatgaaattaaa
acacaaatattagaaaaagaaggccgcttgcctaatgccgttgttgcttgtgttggaggt
ggctctaacgcgataggaacattttatccttttataaaagatgaagtccaattatatggg
gttgaagctgctggggaaggtgcaaatacaaacaaacatgcacttgctataggcaaaggt
aaaccaggtgtactacatggcgcaaaaatgtatcttattcaagatagacacggtcaaata
gaacttgcacattctatttcagctggcttagattatcccggcattggtccagaacattca
tactataacgatattggtagagtccattatacgaatgcaactgacacagaagcaatggaa
gcactcatacgttttactaaagatgaaggcattatccctgccatagaaagcgcgcatgct
ttaagttatgttgaaaaattagcgccacaaatggataaggatcagttgcttgtggtgacg
atttctggtcgtggtgataaagacatggaaactataagacaatacattcaacaaagaggt
gatagccatgcacaataa

DBGET integrated database retrieval system