KEGG   Staphylococcus lugdunensis N920143: SLUG_14680Help
Entry
SLUG_14680        CDS       T01951                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00260  Glycine, serine and threonine metabolism
sln00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01130  Biosynthesis of antibiotics
sln01230  Biosynthesis of amino acids
Module
sln_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLUG_14680 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SLUG_14680 (trpA)
Enzymes [BR:sln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SLUG_14680 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth DUF561 PcrB
Motif
Other DBs
NCBI-ProteinID: CCB53953
Position
1540182..1540922
Genome map
AA seq 246 aa AA seqDB search
MHNKLFIPYVMGDKDFIQHVKLLSEHGADYIEIGVPFSDPVADGPIIMKAANQAIKDNVT
IDTIFEQLKQNQHQIKANYILMTYYNIVMTYGIEAFFKSCEEAGVYGLIIPDLPFELTEK
LKEQVTNYSVKIISLVAMTAPEERIREIATHAEGFIYTVTMNAVTGQNESFHPELKQKLA
LLKSITQIPVVCGFGIRTPEQVSEIIQYADGVVIGSEIVKRLKSQSQEDIITYINSIRQR
LSSQFD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcacaataaattatttattccatatgtaatgggagataaagatttcattcaacatgtc
aaattattaagtgaacatggcgctgattacattgagattggtgtaccattttcagatcct
gttgccgatggaccaatcattatgaaggcagccaaccaagctattaaagataatgtaact
attgatactatatttgaacaacttaaacagaaccaacatcaaattaaagcaaactatatc
cttatgacttattataatattgtcatgacttacggtatagaagcattctttaaatcatgc
gaagaagcaggggtatatggtttaattattccagatttaccatttgaactcactgagaaa
ttaaaagaacaagtgactaactattcagttaaaataatttcattagtagctatgacagcc
cctgaagaacgtataagagaaattgccacacatgcagaaggttttatttatacagtaact
atgaacgctgtaacaggtcaaaatgaatcatttcatcctgaattaaagcaaaaattagcg
ctattaaagtctattacgcaaattcctgttgtctgtggatttggtatacgtacacctgaa
caagttagcgaaatcattcaatatgcagacggtgttgtcattggaagtgaaattgtaaaa
cgcttaaaatctcagtctcaagaggacattatcacttacatcaactcaattcgccaaaga
ttaagcagtcaatttgattaa

DBGET integrated database retrieval system