KEGG   Staphylococcus lugdunensis N920143: SLUG_14680Help
Entry
SLUG_14680        CDS       T01951                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SLUG_14680 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLUG_14680 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SLUG_14680 (trpA)
Enzymes [BR:sln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SLUG_14680 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1540182..1540922
Genome map
AA seq 246 aa AA seqDB search
MHNKLFIPYVMGDKDFIQHVKLLSEHGADYIEIGVPFSDPVADGPIIMKAANQAIKDNVT
IDTIFEQLKQNQHQIKANYILMTYYNIVMTYGIEAFFKSCEEAGVYGLIIPDLPFELTEK
LKEQVTNYSVKIISLVAMTAPEERIREIATHAEGFIYTVTMNAVTGQNESFHPELKQKLA
LLKSITQIPVVCGFGIRTPEQVSEIIQYADGVVIGSEIVKRLKSQSQEDIITYINSIRQR
LSSQFD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcacaataaattatttattccatatgtaatgggagataaagatttcattcaacatgtc
aaattattaagtgaacatggcgctgattacattgagattggtgtaccattttcagatcct
gttgccgatggaccaatcattatgaaggcagccaaccaagctattaaagataatgtaact
attgatactatatttgaacaacttaaacagaaccaacatcaaattaaagcaaactatatc
cttatgacttattataatattgtcatgacttacggtatagaagcattctttaaatcatgc
gaagaagcaggggtatatggtttaattattccagatttaccatttgaactcactgagaaa
ttaaaagaacaagtgactaactattcagttaaaataatttcattagtagctatgacagcc
cctgaagaacgtataagagaaattgccacacatgcagaaggttttatttatacagtaact
atgaacgctgtaacaggtcaaaatgaatcatttcatcctgaattaaagcaaaaattagcg
ctattaaagtctattacgcaaattcctgttgtctgtggatttggtatacgtacacctgaa
caagttagcgaaatcattcaatatgcagacggtgttgtcattggaagtgaaattgtaaaa
cgcttaaaatctcagtctcaagaggacattatcacttacatcaactcaattcgccaaaga
ttaagcagtcaatttgattaa

DBGET integrated database retrieval system