KEGG   Staphylococcus lugdunensis N920143: SLUG_15030Help
Entry
SLUG_15030        CDS       T01951                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLUG_15030 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLUG_15030 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    SLUG_15030 (odhB)
Enzymes [BR:sln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SLUG_15030 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1576341..1577651)
Genome map
AA seq 436 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEDAGVIQEQLA
NEGDTVEVGQAIAIVGEGSAEAKSAEASKSDGKAESKGESESETTTNTANEDTTRDHEQR
QDEAEKADRSDEVKKHTQRVNATPSARRHALKQGVDLAEVAGKSNDVVRKEDIDQRQQQS
SNKKAETAQRKAPETSSSSTPNKPVIREKMSRRKKTAANKLLEVSNNTAMLTTFNEVDMT
NVMELRKRKKEKFMQDHDGTKLGFMSFFTKAAVAALKKYPEVNAEIDGDDMIKKQYYDIG
IAVSTDDGLLVPFVRDCDKKNFAEIEQEIANLAVKARDKKLGLDDMVNGSFTITNGGIFG
SMMSTPIINGSQAAILGMHSIMTRPIAIDKDTIENRPMMYIALSYDHRIIDGKEAVGFLK
TIKDLIENPEDLLLES
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccggaattagcagaatcaattacagaggggaccattgcagaa
tggcttaaaaatgttggcgattctgttgaaaaaggagaagcaattttagaattagaaaca
gataaagttaatgtggaagttgtatcagaagatgcaggtgtgattcaagaacaacttgct
aatgaaggtgatactgttgaagtaggacaagccattgccattgttggagaaggtagtgct
gaagcgaaatcagcagaagcttcaaaatctgacggtaaggctgaatctaaaggtgagtcg
gagtcagaaacaactacaaatacagctaacgaagacacaactcgtgatcatgaacagcga
caagatgaagctgaaaaagcagatcgttctgacgaagtaaaaaaacatactcaacgtgta
aatgccacaccttcagcacgtcgtcatgctttaaaacaaggtgtagaccttgctgaagta
gcaggtaaatctaatgatgtcgtaagaaaagaagatattgatcaacgtcaacaacagtca
tcaaataaaaaagcagaaacggcacaaagaaaagcgccagaaacatcatcatcttcgaca
ccaaacaaaccagttattcgtgaaaaaatgtctcgtcgtaagaaaacagcagctaataaa
ttgcttgaagtatcaaataatacagcaatgttaacgacatttaatgaagttgatatgacg
aatgtgatggaattacgtaaacgtaaaaaagaaaaatttatgcaagatcatgatggtaca
aaattaggatttatgtcattcttcacaaaagcagcagtagccgcgttgaaaaaatatcca
gaagtcaatgctgaaattgatggagatgacatgatcaagaaacaatattatgatattggt
atagctgtatcaacagatgatggtttattagttccatttgtaagggactgtgataagaag
aattttgcagaaatcgaacaagaaattgctaatttagcagttaaagcgcgtgataaaaaa
ttaggcttagacgacatggtaaatggatcatttacaattactaacggtggtatcttcggt
tcaatgatgagtacgccaatcatcaatggtagtcaagcagcaatattaggtatgcattca
attatgacacgtccaattgcaattgataaagatacaattgaaaatcgaccaatgatgtat
attgctttaagctatgatcacagaattattgatggtaaagaagcagtaggtttcttgaaa
acaattaaagatctcattgaaaatccagaagatttattattagaatcataa

DBGET integrated database retrieval system