KEGG   Staphylococcus lugdunensis N920143: SLUG_15160Help
Entry
SLUG_15160        CDS       T01951                                 

Gene name
dfrB
Definition
dihydrofolate reductase type I (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLUG_15160 (dfrB)
   00670 One carbon pool by folate
    SLUG_15160 (dfrB)
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SLUG_15160 (dfrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590323..1590808)
Genome map
AA seq 161 aa AA seqDB search
MTLSILVAHDQQRVIGYNNDLPWHLPNDLKHVKKLSTGNTLVMGRGTFESIGKPLPNRRN
VVLTHNQNFQHDGVDVIHSIDEIYNLPGHVFIFGGQSLFDKMIDKVDDMYITVLEGKFKG
DTFFPPYTFEEWEVASSEEGVLDEKNTIPHTFLHLVRRKKN
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcaatattagtagcacatgatcaacaacgcgtgattggctataataacgat
ttaccatggcatttacctaatgatttaaagcatgtgaaaaaattgtcaacaggcaatacg
ttagtcatgggtagaggaacttttgaatccattggtaaacctctacctaatcgacgtaat
gttgtattaacacataatcaaaattttcaacatgatggtgttgatgttatccattctatt
gatgaaatatataatttgccaggtcatgtatttatttttggtgggcaaagtcttttcgac
aaaatgattgataaagtagatgatatgtatattactgtgttagaagggaaatttaaaggt
gatacgttctttccgccatatacttttgaagagtgggaagttgcatcttcagaagaaggt
gttttggatgaaaagaatacaattcctcatacttttttacatttagttagacgtaagaaa
aattag

DBGET integrated database retrieval system