KEGG   Staphylococcus lugdunensis N920143: SLUG_15700Help
Entry
SLUG_15700        CDS       T01951                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00260  Glycine, serine and threonine metabolism
sln00750  Vitamin B6 metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01230  Biosynthesis of amino acids
Module
sln_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLUG_15700 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SLUG_15700 (thrC)
Enzymes [BR:sln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SLUG_15700 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: CCB54059
Position
complement(1646655..1647716)
Genome map
AA seq 353 aa AA seqDB search
MKRWQGLVEEYRSYLPVNEETPQLTLNEGNTPLIHCDYLSQKLNINLYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAKDGEIELVNSVNPFRIEGQKTASFEVIEQLTKAPD
ILAIPVGNAGNITAYWQGFKEYHDKHGVTLPRLFGFQAEGASPIVQNKVIKNPETIATAI
RIGNPASWTKATAALNESHGLIDSVTDEEILEAYQIMTSKEGIFSEPASNASIAGLIKLH
RAGQLPKNQTVVAVLTGNGLKDPDTAISLLDNPIQPLPNDKRSIIEYIKGVLK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggattagtagaagaatatcggtcttatttaccggttaatgaagag
acgcctcaacttacactaaatgaaggaaatacaccattaattcattgtgactatctgtca
caaaaattaaatataaatctatacgtaaagtatgagggagcaaatcctactggctcgttt
aaagaccgtggtatggttatggctgtgacaaaagcaaaagaacaagggaaaaagattgtg
atatgtgcttcgacaggaaatacatctgcttctgcagctgcatatgctgctagagcaggc
ttaaaagcaattgtagttattccagaaggtaaaatagcactcggaaaattatcacaagct
gtcatgtatggtgctgaaatagtgtcaattgaaggtaactttgatgaagcgttagaaatt
gttaaagaaattgcgaaagatggtgagattgaattagttaattcagttaatccgttccgc
attgaaggacaaaagacggcatcatttgaagttattgagcaattaacaaaagctccggat
attttagctataccggttggtaatgctggtaatattacagcatattggcaaggatttaag
gaatatcatgataagcatggtgtaacattaccacgtttatttggttttcaagcagaaggt
gcttctcctattgttcaaaataaagtcattaaaaatccagaaacaatagcgactgcgatt
cgtataggaaatcctgcgagttggactaaagcaaccgctgcattaaatgaatctcacgga
ttaattgatagtgtaactgatgaagaaattttagaagcttatcaaattatgacttcaaaa
gaaggcatatttagtgagccagcaagtaatgcatcaattgcaggattaattaaattacac
cgtgctggacagttgccaaagaatcagacagttgtagctgtattaacgggtaacggactt
aaagatcctgatacggctatatcacttctagataatccgattcaacctttacctaatgat
aaacgaagtattattgaatatatcaaaggggttcttaaataa

DBGET integrated database retrieval system