KEGG   Staphylococcus lugdunensis N920143: SLUG_16530Help
Entry
SLUG_16530        CDS       T01951                                 

Definition
putative CoA synthetase protein
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLUG_16530
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLUG_16530
   00640 Propanoate metabolism
    SLUG_16530
   00660 C5-Branched dibasic acid metabolism
    SLUG_16530
Enzymes [BR:sln01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SLUG_16530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1740040..1741206)
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAKEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEQGCDIQKEYYVGFVIDRATDR
ITLMASEEGGTEIEEVAATTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESINKAAKF
LISLYNVFVEKDCSIVEINPLVTTGDGEVLALDAKINFDDNALFRHKDIQELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDDNVKGIFVNIFGGIMKCDVIAEGIVAAVKEVELTLPLVVRLEGTNVERGKEI
LNDSGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaaggtaaagaaatatttcgttctatgggcgtagctgttcca
gaaggacgtgtcgcatttactgctaaagaagcggtggaaaaagcgaaagaattaaattca
gatgtatatgtggttaaagcacagatccacgctgggggtagaggtaaagcaggtggtgtt
aaaattgctaaatcactttctgaagttgaaacatacgcaaatgaattattaggtaaacaa
ttggtaacgcatcaaactggtccagaaggtaaagaagtgaaacgcttatatatagaacaa
ggttgcgatattcaaaaagagtattatgtcggttttgttattgaccgtgcaaccgatcgt
atcactttaatggcttctgaagagggcggtactgaaattgaagaagtagctgcaacaaca
ccagaaaaaatctttaaagaaacgattgacccagtggtaggtttatcgccttaccaagcg
cgtcgaattgcatttaatattaatattcctaaagaatctatcaacaaagctgcaaaattt
ttaatttctttatataacgtatttgtagaaaaagattgttctattgtggaaattaacccg
ttggtaacaactggagacggtgaagtattagctttagatgctaaaattaactttgatgat
aatgcattattcagacataaagatattcaagaattgcgtgatttagaagaagaagatcca
aaagaaatcgaagcatctaaatatgacttatcatacatcgcattagatggagatatcggt
tgtatggttaacggtgctggtttagcaatggcaacaatggatacaattaatcattttggt
ggaaatccagctaacttcctagacgtaggtggcggtgctacgaaagaaaaagttactgaa
gcttttaaaattatcttaggtgatgacaatgttaaaggtatctttgtaaacattttcgga
ggaattatgaaatgtgacgttattgcagaaggtattgtagcagcagtgaaagaagtagaa
ttaactttaccattagttgtgcgcttagaaggtacgaatgttgaacgcggtaaagagatt
ttaaatgattcaggtttagcaatcgagccagcagctactatggctgaaggtgctcaaaaa
attgttaagcttgttaaagaagcgtaa

DBGET integrated database retrieval system