KEGG   Staphylococcus lugdunensis N920143: SLUG_16640Help
Entry
SLUG_16640        CDS       T01951                                 

Definition
(GenBank) putative ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLUG_16640
   00630 Glyoxylate and dicarboxylate metabolism
    SLUG_16640
   00640 Propanoate metabolism
    SLUG_16640
   00650 Butanoate metabolism
    SLUG_16640
  Lipid metabolism
   00071 Fatty acid degradation
    SLUG_16640
   00072 Synthesis and degradation of ketone bodies
    SLUG_16640
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLUG_16640
   00310 Lysine degradation
    SLUG_16640
   00380 Tryptophan metabolism
    SLUG_16640
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLUG_16640
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLUG_16640
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SLUG_16640
Enzymes [BR:sln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SLUG_16640
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SLUG_16640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1751564..1752709)
Genome map
AA seq 381 aa AA seqDB search
MREAVIVAAKRTAFGKYAGQLKHLEPEQLLLPLFQFYQNKYPNICGHIQDVIIGNTVGNG
GNVARKSLLTANLEYGIPGLTLDRQCGSGLESVIYACRMIQCGAGSVYLAGGVESTSRAP
WKIKRPQSVYDTNLPQFYERASFAPDNQDVSMIQAAENVAQHYHISRDEQDEFAFRSHQK
TASFYQNGKIKKEIVPIHSKGQTFAQDESLKPRLTPAKFSRFKPLLPGGTVTVGNSCMKN
DGAALILVLEKQLAKRFGFSEGLVFKQAVTKGVDPTMLGIGPVAAVQQLLTQTPFSINDI
NTFEINEAFSSQVLACQQQLHIPIDKLNIWGGAIATGHPYAASGAALITRLFNMEDKMTS
IATMGIGGGMGNAALLQREHF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgttattgttgcagccaaacgcacagcatttggtaagtatgcgggtcaa
cttaaacatttagaaccagaacaattattacttccactatttcaattttatcagaataaa
tatcccaatatatgtggtcatattcaggatgttatcattggtaatacagtagggaatgga
ggtaatgtggcacgtaaatcattgttgacggcaaatttagaatacggcatacctggttta
acattggatcgccaatgtggttcggggttggaaagtgtcatttatgcatgtcggatgatt
caatgtggtgcagggtcagtatatctagctggtggcgttgaaagtacaagtcgtgcgcct
tggaaaattaaaagacctcaatcagtttatgatactaacttacctcaattttatgagcgt
gcttcttttgcacctgataatcaagatgtttcaatgattcaagcggctgaaaatgtagcg
caacattatcatataagccgtgatgaacaagatgaatttgcttttcgcagtcatcagaag
actgcatccttttatcaaaacggtaaaattaagaaagagattgttccgattcactcaaaa
ggacaaacttttgcgcaagatgaaagtttaaaaccacgattaacaccagctaaatttagt
cgatttaagccacttttgccaggaggaacggtaactgtaggaaatagttgtatgaaaaat
gatggtgcagctttgatattggtcttagagaaacaactcgcaaaacgatttggatttagc
gaaggactcgtctttaagcaagctgtaacaaaaggtgttgatccaaccatgctaggcatt
ggtccagttgctgctgtccaacaattattaacacaaacgcctttttctataaatgatatt
aatacatttgaaattaatgaggcatttagttcacaggtattagcttgtcagcaacaatta
catatacctatagataaactcaatatttggggaggtgcgatagcgactggtcatccatac
gcagcgagtggtgcagcgctaataacacgcttatttaatatggaagataagatgacgagc
attgctacaatgggcattggaggaggaatgggtaatgcggccctcttacaacgagaacac
ttttaa

DBGET integrated database retrieval system