KEGG   Staphylococcus lugdunensis N920143: SLUG_20200Help
Entry
SLUG_20200        CDS       T01951                                 

Gene name
est
Definition
(GenBank) putative carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Brite
Enzymes [BR:sln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SLUG_20200 (est)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH PhoPQ_related Abhydrolase_3 BAAT_C DUF2048 UPF0227 Abhydrolase_5 DUF4611 Esterase DUF5363
Motif
Other DBs
NCBI-ProteinID: CCB54540
Position
complement(2133966..2134706)
Genome map
AA seq 246 aa AA seqDB search
MQIKLPQPFFFEEGPRAVLLLHGFTGNSSDVRQLGRYLQKKGITSYAPQYEGHAAPPEEI
LKSSPHVWFKDALDGYDFLKEKGYDDIVVAGLSLGGVFALKLSLNRDVKGIVTMCAPMEG
KTEGTIYDGFLEYARNFKKYEGKDQATIDQEMENFHPTETLKELSATLSEVRDVVEEVLD
PILVIQAEHDEMIDPQSANYIYDHVDSEQKDIKWYANSGHVITIDKEKEQVFDDINDFLN
TLEWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaaactaccccaaccattcttttttgaagaaggcccccgtgctgtcttactg
cttcatggtttcacaggaaattcttcagatgtaagacaactagggcgttatttacagaaa
aagggaatcacctcttacgcgcctcaatatgaaggtcatgcggctccgccagaagaaatt
ttaaaatcaagcccacatgtctggtttaaagatgcattagatggttatgattttcttaaa
gaaaaaggctatgacgatattgtcgttgctggattatctctaggcggtgtttttgcacta
aaattaagcttaaatcgagatgtaaagggtattgtaacgatgtgtgctcctatggaaggt
aagactgaaggaacaatatacgatggtttccttgaatatgcacgcaacttcaaaaaatat
gaaggaaaagatcaagcaacgattgatcaagaaatggaaaactttcacccaactgagaca
ttaaaagagctaagtgcgacattaagtgaagttcgagatgttgtcgaagaggtgctggat
cccattttggttatacaagcagaacatgatgagatgattgatcctcaatcagccaattat
atatatgaccatgttgattcagaacaaaaagacattaaatggtatgccaattcaggtcac
gtcattacgattgataaagaaaaagaacaagtttttgatgacattaatgactttttaaat
acgttagaatggtcagagtaa

DBGET integrated database retrieval system