KEGG   Staphylococcus lugdunensis N920143: SLUG_20250Help
Entry
SLUG_20250        CDS       T01951                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00051  Fructose and mannose metabolism
sln00562  Inositol phosphate metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
sln01230  Biosynthesis of amino acids
Module
sln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sln_M00002  Glycolysis, core module involving three-carbon compounds
sln_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_20250 (tpiA)
   00051 Fructose and mannose metabolism
    SLUG_20250 (tpiA)
   00562 Inositol phosphate metabolism
    SLUG_20250 (tpiA)
Enzymes [BR:sln01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SLUG_20250 (tpiA)
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SLUG_20250 (tpiA)
  Exosomal proteins of bladder cancer cells
   SLUG_20250 (tpiA)
  Exosomal proteins of melanoma cells
   SLUG_20250 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCB54545
Position
complement(2138879..2139640)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTVQEAKDFVNNLPTLPDEKEVESVICAPTIQLDALITLVKEGKATG
LKIGAQNTYFEDNGAYTGETSPVALADLGVKYVVIGHSERRELFHETDEDVNKKAHAVFN
HHMTPIICVGETDEERENGKANDIVSNQVKKAVAGLTDAQLKEVVIAYEPIWAIGTGKSA
TSDDANEMCAQVRRTLAEVSSQDVADATRIQYGGSVKPNNVKEYMAQPDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattattgctggcaactggaaaatgaataaaacagttcaagaagcaaaa
gattttgtaaataatttgccaactttaccagatgaaaaagaagtagagtcagtaatctgt
gcaccaacaattcaacttgatgctttgattacgttagtaaaagaaggtaaagcaacaggc
cttaaaatcggtgctcaaaatacttattttgaggataatggtgcttatacaggtgaaaca
tctcctgtagcattagctgatttaggcgttaaatacgtggttatcggacactctgaacgt
cgtgaattattccatgaaacagatgaagatgtaaataaaaaagcacatgcagtctttaac
catcacatgacaccaattatttgtgtaggtgaaacggatgaagaacgtgaaaatggcaaa
gcaaacgatattgtaagtaatcaagttaaaaaagctgttgctggcttaactgatgcacaa
cttaaagaagttgtaattgcttatgaaccaatttgggcaattggtactggtaaatctgca
acatctgatgatgcgaatgaaatgtgtgcacaagtacgacgcacattagctgaagtttct
agccaagatgtagcagacgcaacacgcattcaatacggtggtagcgttaaaccaaacaac
gtaaaagaatacatggcacaaccagatattgatggcgctttagtcggtggcgcatctctt
aaagtggaagatttcgttcaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system