KEGG   Staphylococcus lugdunensis N920143: SLUG_21990Help
Entry
SLUG_21990        CDS       T01951                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SLUG_21990 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_21990 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SLUG_21990 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SLUG_21990 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLUG_21990 (adhA)
   00626 Naphthalene degradation
    SLUG_21990 (adhA)
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SLUG_21990 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2323297..2324307)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHKVSLEDKTLRSLKPGEALVKTEFCGVCHTDLHVKNADFGDVTGRILGHEG
IGKVIEVADDVTALKVGDRVSIAWMYAACGRCEYCTSGRETLCRDVQNAGYTVDGAMAEE
VIVNANYAVKVPDDLDPAAASSITCAGVTTYKAVKVSKIKPGQWIGIFGIGGLGNLALQY
AKNVFNAKVVAFDISDDKLNFAKELGADAVVNTKNQDATEIVNQLTNNKGLDATVITAVA
KTPFNQAVDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIEVVGSLVGTRQDLKEAFQFSA
EGKVVPKVKTRDLEDINDIFEEMEQGKITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgttgttacgcaagatcataaagtaagtttagaagataaaactttacgt
tctttgaagcctggagaagcacttgttaagacagaattttgtggtgtttgtcatactgat
ttacatgtgaaaaatgcggattttggtgatgttacaggtagaatactaggtcatgaagga
atcggaaaagtgattgaagttgccgatgatgttaccgcattaaaagtcggcgatcgtgtg
tcaatcgcttggatgtacgcagcttgtggacgttgtgaatattgtacttctggacgtgaa
acattatgtcgtgatgtccaaaatgcaggttatacggtcgatggtgcaatggcagaagag
gttattgtaaatgcaaattatgccgttaaagtgcctgatgacttagatcctgccgcagct
tcatcaattacttgtgctggtgttacaacatataaagcggttaaagtgagcaaaattaaa
cctggacaatggattggaatatttggtatcggtggtttaggtaatttagcacttcaatat
gctaagaatgtgtttaatgctaaagtcgttgcatttgatattagtgatgataagttgaat
tttgccaaagaattaggtgccgatgcagtcgtgaacactaaaaatcaagatgcaactgaa
atcgttaatcaactaaccaataataaaggtttagatgccacagtgattactgcagtagcg
aaaacaccttttaaccaagcagttgatgttgttaaagctggtgcacgtgttgttgctgtt
ggtttacctgtagacaaaatggatttagatataccacgtcttgtgttagatggtattgaa
gtcgtcggttctttagtaggaacacgtcaagacttaaaagaagctttccaattttctgca
gaaggtaaagttgttcctaaagttaaaacacgtgacttagaggatattaatgatatcttt
gaagaaatggaacaaggtaaaatcactggtcgtatggttattaagttttaa

DBGET integrated database retrieval system