KEGG   Staphylococcus lugdunensis N920143: SLUG_21990Help
Entry
SLUG_21990        CDS       T01951                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00071  Fatty acid degradation
sln00350  Tyrosine metabolism
sln00625  Chloroalkane and chloroalkene degradation
sln00626  Naphthalene degradation
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_21990 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SLUG_21990 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SLUG_21990 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLUG_21990 (adhA)
   00626 Naphthalene degradation
    SLUG_21990 (adhA)
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SLUG_21990 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C Methyltransf_31 ADH_N_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CCB54724
Position
complement(2323297..2324307)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHKVSLEDKTLRSLKPGEALVKTEFCGVCHTDLHVKNADFGDVTGRILGHEG
IGKVIEVADDVTALKVGDRVSIAWMYAACGRCEYCTSGRETLCRDVQNAGYTVDGAMAEE
VIVNANYAVKVPDDLDPAAASSITCAGVTTYKAVKVSKIKPGQWIGIFGIGGLGNLALQY
AKNVFNAKVVAFDISDDKLNFAKELGADAVVNTKNQDATEIVNQLTNNKGLDATVITAVA
KTPFNQAVDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIEVVGSLVGTRQDLKEAFQFSA
EGKVVPKVKTRDLEDINDIFEEMEQGKITGRMVIKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgttgttacgcaagatcataaagtaagtttagaagataaaactttacgt
tctttgaagcctggagaagcacttgttaagacagaattttgtggtgtttgtcatactgat
ttacatgtgaaaaatgcggattttggtgatgttacaggtagaatactaggtcatgaagga
atcggaaaagtgattgaagttgccgatgatgttaccgcattaaaagtcggcgatcgtgtg
tcaatcgcttggatgtacgcagcttgtggacgttgtgaatattgtacttctggacgtgaa
acattatgtcgtgatgtccaaaatgcaggttatacggtcgatggtgcaatggcagaagag
gttattgtaaatgcaaattatgccgttaaagtgcctgatgacttagatcctgccgcagct
tcatcaattacttgtgctggtgttacaacatataaagcggttaaagtgagcaaaattaaa
cctggacaatggattggaatatttggtatcggtggtttaggtaatttagcacttcaatat
gctaagaatgtgtttaatgctaaagtcgttgcatttgatattagtgatgataagttgaat
tttgccaaagaattaggtgccgatgcagtcgtgaacactaaaaatcaagatgcaactgaa
atcgttaatcaactaaccaataataaaggtttagatgccacagtgattactgcagtagcg
aaaacaccttttaaccaagcagttgatgttgttaaagctggtgcacgtgttgttgctgtt
ggtttacctgtagacaaaatggatttagatataccacgtcttgtgttagatggtattgaa
gtcgtcggttctttagtaggaacacgtcaagacttaaaagaagctttccaattttctgca
gaaggtaaagttgttcctaaagttaaaacacgtgacttagaggatattaatgatatcttt
gaagaaatggaacaaggtaaaatcactggtcgtatggttattaagttttaa

DBGET integrated database retrieval system