KEGG   Staphylococcus lugdunensis N920143: SLUG_23130Help
Entry
SLUG_23130        CDS       T01951                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sln00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2450677..2451525)
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRDDGYHEIAMIMTTVDLNDRLSFKKRTDNKIIVDIEHNYVP
NDSKNLAYRAAELMTHTYGIQQGVTIAIDKDIPVSAGLAGGSADAAATMRGMNRLFDLGL
TLHDLAQLGIQIGTDVPFCIYNQTALCTGLGEKIEFLNKPPATWVVLAKPDLGISSPDVF
KALDLNIAHAVHTEACKAAIKHGDYQKLCHSLSNRLELVSMAMHPEIKKIKNNMLQCGAD
GALMSGSGPTVYALAQKESQAKKIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggctcctgccaagataaattttacgctcgacacccttttcaaaaga
gatgacggctatcatgaaattgcaatgattatgacgacggttgatttaaatgatagacta
tcatttaaaaaacgtacggataataagattattgtcgacattgagcacaactatgtgcct
aatgatagtaaaaatttagcttatagagctgccgaattaatgacacatacttatgggatt
cagcaaggtgtaacgatagcgattgataaagacattccggtatcagctggtttagctgga
ggttcagcagatgctgctgcaacgatgagaggtatgaatcgcctgttcgacttgggttta
acattgcatgatttagctcaattgggtattcaaattggcacagatgtaccgttttgtatt
tataatcaaaccgctttatgtactggcttaggtgagaagattgaatttttaaacaaaccg
ccagcgacatgggtagttttagctaaaccagatttaggtatttcatcgccagacgttttt
aaagctttagatttaaatattgcgcatgccgttcacacagaagcgtgcaaggcagcgatt
aaacatggtgactatcaaaagttatgccacagtctttctaatcgcttggaattagtgtct
atggctatgcacccagaaataaaaaagattaaaaataacatgcttcaatgtggtgcagat
ggcgctttaatgagtggtagtggaccaactgtttatgcattagcacaaaaagaaagtcaa
gctaagaaaatatataatgcagtaaacggctgttgtaatgaagtttatttagtaagatta
ctaggatag

DBGET integrated database retrieval system