KEGG   Staphylococcus lugdunensis N920143: SLUG_23560Help
Entry
SLUG_23560        CDS       T01951                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sln  Staphylococcus lugdunensis N920143
Brite
Enzymes [BR:sln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SLUG_23560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2509333..2510061)
Genome map
AA seq 242 aa AA seqDB search
MKLTSPRPIYLEGHREEAILLLHSFTGTIRDVKPLAQALHKQGFTCYAPNYRGHGLPLTE
LIAFDINDWWHDAQNGYKFLQQQGYKQIYVTGVSLGGLLTLKIAETYPVAKIAVMSAPHQ
KAETGIAWRMERYGQRMNELQHLSDSEAQKQLNTIKQYHSQLTAFRLFITDIMHDLAHIN
ADAMVLYGEQDDASYQESAQYIAEHMTQTNKSLTAYRLSKHLMTYGEGSEDVINDIVTFF
QS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaacttcgccaagaccgatatatttagaaggacatcgtgaagaagctatctta
ttattacattcatttaccggcacgattagagatgtgaaaccattagcgcaagcattgcat
aaacaaggttttacttgttacgcaccaaattatcgagggcatggattaccgcttactgaa
ttaatagcgtttgatattaatgattggtggcatgatgcacaaaatggatacaagttttta
caacaacaaggctacaaacaaatatatgttacaggcgtttctttaggtggattattgaca
cttaagatagctgaaacgtatcctgtggctaagattgctgttatgtcagctccccatcaa
aaagcagaaacaggtattgcgtggcgtatggaacgttatggacagcgtatgaatgaatta
caacacctgtctgatagtgaagcacaaaagcaattaaacacaattaaacaatatcattca
caattgaccgcatttagactttttataacagatatcatgcatgatttagcacatatcaat
gcagatgcaatggttctatatggtgaacaagatgacgcttcttatcaagaaagcgcacaa
tatattgctgagcatatgacacaaacaaataagtcattaactgcataccggttaagtaaa
cacttaatgacttatggtgaagggagtgaagatgtaatcaacgatatagtgacatttttt
caatcttga

DBGET integrated database retrieval system