KEGG   Staphylococcus lugdunensis N920143: SLUG_23800Help
Entry
SLUG_23800        CDS       T01951                                 

Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SLUG_23800
   01230 Biosynthesis of amino acids
    SLUG_23800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_23800
  Energy metabolism
   00680 Methane metabolism
    SLUG_23800
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLUG_23800
Enzymes [BR:sln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SLUG_23800
Exosome [BR:sln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SLUG_23800
  Exosomal proteins of melanoma cells
   SLUG_23800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2536482..2537060)
Genome map
AA seq 192 aa AA seqDB search
MKIYFVRHGESQANLDNHQGKTYYCGQLDVDLTQTGRNSAQALESYFNTKDIQHVYVSDL
KRTVQTYSCIFPYDIPTTLTPLLRERSLGVFEGKNQQELEQISEYKKYFTQSSYMNFRNS
YTQRVPQGENYQDVIDRFEAFFNHTVNSTYDTIVVVAHQILIRCALVYLGVLKREDAKQI
HIENCKPIVVEI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatattttgttagacacggagaatcacaagctaatttagataatcatcaaggt
aagacatactattgcggacaacttgatgttgatctcacacagacgggaagaaatagtgca
caggcacttgaatcttattttaatactaaagatattcagcatgtctatgtgtcagattta
aagcgcacagtacagacgtatagctgtattttcccatatgatattcctacgacgctaacg
ccattgcttagagaacgttccctaggtgtatttgaggggaaaaatcaacaagaactcgaa
cagatatccgaatataagaaatattttacccaatcatcatatatgaattttagaaatagc
tatactcaacgtgtacctcaaggagaaaactatcaagacgttattgatcgttttgaagcg
ttttttaatcataccgtcaattcgacgtatgatactattgtagttgtggcgcatcaaata
cttattcgctgtgccttagtgtatttaggtgtattaaaacgtgaagacgccaagcaaata
catattgaaaactgtaaacccattgtggtagaaatataa

DBGET integrated database retrieval system